catP

Accession ARO:3002686
CARD Short NamecatP
DefinitioncatP is a transposon and chromosome-encoded variant of the cat gene found in Clostridium perfringens and Neisseria meningitidis.
AMR Gene Familychloramphenicol acetyltransferase (CAT)
Drug Classphenicol antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesAvibacterium paragallinarumg+wgs, Faecalibacterium prausnitziig, Haemophilus influenzaewgs, Neisseria meningitidiswgs, Pasteurella multocidag+gi, Streptococcus agalactiaeg+wgs, Streptococcus pyogeneswgs, Streptococcus suisg
Resistomes with Sequence VariantsAvibacterium paragallinarumg+wgs, Faecalibacterium prausnitziig, Haemophilus influenzaewgs, Neisseria meningitidiswgs, Pasteurella multocidag+gi, Streptococcus agalactiaeg+wgs, Streptococcus pyogeneswgs, Streptococcus suisg
Classification8 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ chloramphenicol acetyltransferase (CAT) [AMR Gene Family]
+ confers_resistance_to_antibiotic azidamfenicol [Antibiotic]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
+ confers_resistance_to_antibiotic thiamphenicol [Antibiotic]
Publications

Bannam TL, et al. 1995. Mol Microbiol 16(3): 535-551. Molecular genetics of the chloramphenicol-resistance transposon Tn4451 from Clostridium perfringens: the TnpX site-specific recombinase excises a circular transposon molecule. (PMID 7565113)

Galimand M, et al. 1998. N Engl J Med 339(13): 868-874. High-level chloramphenicol resistance in Neisseria meningitidis. (PMID 9744970)

Resistomes

Prevalence of catP among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Avibacterium paragallinarum6.25%0%2.94%0%
Faecalibacterium prausnitzii13.33%0%0%0%
Haemophilus influenzae0%0%0.13%0%
Neisseria meningitidis0%0%0.37%0%
Pasteurella multocida1.43%0%0%33.33%
Streptococcus agalactiae0.93%0%0.13%0%
Streptococcus pyogenes0%0%0.05%0%
Streptococcus suis0.8%0%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|AAB51421.1|+|catP [Clostridium perfringens]
MVFEKIDKNSWNRKEYFDHYFASVPCTYSMTVKVDITQIKEKGMKLYPAMLYYIAMIVNRHSEFRTAINQDGELGIYDEMIPSYTIFHND
TETFSSLWTECKSDFKSFLADYESDTQRYGNNHRMEGKPNAPENIFNVSMIPWSTFDGFNLNLQKGYDYLIPIFTMGKYYKEDNKIILPL
AIQVHHAVCDGFHICRFVNELQELINS


>gb|U15027.1|+|1-624|catP [Clostridium perfringens]
ATGGTATTTGAAAAAATTGATAAAAATAGTTGGAACAGAAAAGAGTATTTTGACCACTACTTTGCAAGTGTACCTTGTACATACAGCATG
ACCGTTAAAGTGGATATCACACAAATAAAGGAAAAGGGAATGAAACTATATCCTGCAATGCTTTATTATATTGCAATGATTGTAAACCGC
CATTCAGAGTTTAGGACGGCAATCAATCAAGATGGTGAATTGGGGATATATGATGAGATGATACCAAGCTATACAATATTTCACAATGAT
ACTGAAACATTTTCCAGCCTTTGGACTGAGTGTAAGTCTGACTTTAAATCATTTTTAGCAGATTATGAAAGTGATACGCAACGGTATGGA
AACAATCATAGAATGGAAGGAAAGCCAAATGCTCCGGAAAACATTTTTAATGTATCTATGATACCGTGGTCAACCTTCGATGGCTTTAAT
CTGAATTTGCAGAAAGGATATGATTATTTGATTCCTATTTTTACTATGGGGAAATATTATAAAGAAGATAACAAAATTATACTTCCTTTG
GCAATTCAAGTTCATCACGCAGTATGTGACGGATTTCACATTTGCCGTTTTGTAAACGAATTGCAGGAATTGATAAATAGTTAA