catS

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002688
CARD Short NamecatS
DefinitioncatS is a chromosome-encoded variant of the cat gene found in Streptococcus pyogenes.
AMR Gene Familychloramphenicol acetyltransferase (CAT)
Drug Classphenicol antibiotic
Resistance Mechanismantibiotic inactivation
Classification8 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ chloramphenicol acetyltransferase (CAT) [AMR Gene Family]
+ confers_resistance_to_antibiotic azidamfenicol [Antibiotic]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
+ confers_resistance_to_antibiotic thiamphenicol [Antibiotic]
Resistomes with Sequence VariantsAnaerostipes hadruswgs, Enterocloster clostridioformiswgs, Faecalibacterium prausnitziiwgs, Neisseria brasiliensisg+wgs, Parvimonas micrag, Streptococcus agalactiaewgs
Publications

Trieu-Cuot P, et al. 1993. Antimicrob Agents Chemother 37(12): 2593-2598. Study of heterogeneity of chloramphenicol acetyltransferase (CAT) genes in streptococci and enterococci by polymerase chain reaction: characterization of a new CAT determinant. (PMID 8109922)

Resistomes

Prevalence of catS among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Anaerostipes hadrus0%0%6.9%0%0%
Enterocloster clostridioformis0%0%2.33%0%0%
Faecalibacterium prausnitzii0%0%0.97%0%0%
Neisseria brasiliensis100%0%100%0%0%
Parvimonas micra30%0%0%0%0%
Streptococcus agalactiae0%0%0.06%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300


>gb|CAA52904.1|+|catS [Streptococcus pyogenes] Partial
FTNIPCTYSMTVKLDITQIKKKRMKLYPAMLYYLATIVNRHSEFRTAINQEGELGIYDEMIPSYTIFHEDTETFSNLWTPYIPDFEAFSM
AYANDMQRYGSNYGMIGKPDIPENVFNVSMIPWSTFDSFNLNLQKGYDYLIPIFTMGKYYRDDEKIILPLAIQV


>gb|X74948.1|+|1-492|catS [Streptococcus pyogenes] Partial
TTTACGAATATACCTTGCACATACAGTATGACTGTTAAATTGGATATTACACAAATAAAAAAGAAACGAATGAAATTATACCCTGCGATG
CTTTATTATCTTGCAACGATTGTAAACCGTCATTCAGAGTTTAGAACGGCAATTAATCAGGAGGGTGAACTGGGAATATATGACGAGATG
ATACCCAGCTATACCATATTCCATGAGGACACAGAGACATTTTCCAACCTTTGGACACCATACATACCAGATTTTGAAGCATTTTCTATG
GCGTATGCGAATGATATGCAAAGGTATGGAAGCAATTATGGAATGATAGGAAAACCAGATATACCAGAAAATGTTTTTAATGTATCGATG
ATACCATGGTCAACCTTCGATAGCTTTAATCTGAATTTGCAGAAAGGATATGATTATTTGATTCCTATTTTTACGATGGGGAAATATTAC
AGAGATGATGAAAAAATCATACTTCCTCTCGCCATCCAAGTT

Curator Acknowledgements
Curator Description Most Recent Edit