Streptomyces lividans cmlR

Accession ARO:3002690
DefinitioncmlR is a plasmid or chromosome-encoded chloramphenicol resistance determinant (putative transmembrane protein) that is found in Escherichia coli and Streptomyces lividans
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classtetracycline antibiotic, penam, nucleoside antibiotic, benzalkonium chloride, glycylcycline, lincosamide antibiotic, rhodamine, oxazolidinone antibiotic, antibacterial free fatty acids, phenicol antibiotic, peptide antibiotic, fosfomycin, isoniazid, rifamycin antibiotic, diaminopyrimidine antibiotic, acridine dye, macrolide antibiotic, bicyclomycin, fluoroquinolone antibiotic, nitroimidazole antibiotic, cephalosporin
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Classification30 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ participates_in antibiotic efflux [Resistance Mechanism]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
+ determinant of phenicol resistance
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
Publications

Dittrich W, et al. 1991. Mol Microbiol 5(11): 2789-2797. An amplifiable and deletable chloramphenicol-resistance determinant of Streptomyces lividans 1326 encodes a putative transmembrane protein. (PMID 1779766)

Dorman CJ, et al. 1986. Gene 41(2-3): 349-353. Nucleotide sequence of the R26 chloramphenicol resistance determinant and identification of its gene product. (PMID 3011609)

Resistomes

Prevalence of Streptomyces lividans cmlR among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
No prevalence data


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 600


>gb|CAA42594.1|+|cml [Streptomyces lividans 1326]
MPLPLYLLAVAVCAMGTSEFMLAGLVPDIASDLGVTVGTAGTLTSAFATGMIVGAPLVAALARTWPRRSSLLGFILAFAAAHAVGAGTTS
FPVLVACRVVAALANAGFLAVALTTAAALVPADKQGRALAVLLSGTTVATVAGVPGGSLLGTWLGWRATFWAVAVCCLPAAFGVLKAIPA
GRATAAATGGPPLRVELAALKTPRLLLAMLLGALVNAATFASFTFLAPVVTDTAGLGDLWISVALVLFGAGSFAGVTVAGRLSDRRPAQV
LAVAGPLLLVGWPALAMLADRPVALLTLVFVQGALSFALGSTLITRVLYEAAGAPTMAGSYATAALNVGAAAGPLVAATTLGHTTGNLGP
LWASGLLVAVALLVAFPFRTVITTAAPADATR


>gb|X59968|+|508-1686|cml [Streptomyces lividans 1326]
ATGCCTCTTCCGCTGTACCTGCTCGCCGTGGCCGTCTGCGCCATGGGCACCTCGGAGTTCATGCTCGCCGGTCTCGTGCCGGACATCGCC
TCGGATCTCGGCGTCACCGTCGGGACCGCAGGCACGCTCACCTCCGCCTTCGCGACCGGCATGATCGTCGGCGCTCCCCTCGTGGCGGCG
CTGGCCCGCACCTGGCCCAGGCGTTCCAGCCTCCTCGGATTCATCCTCGCCTTCGCGGCGGCACACGCCGTGGGAGCCGGCACCACGAGC
TTCCCCGTCCTGGTGGCCTGCCGGGTCGTGGCCGCGCTCGCGAACGCGGGATTCCTCGCGGTCGCACTGACGACTGCCGCCGCACTGGTC
CCTGCCGACAAGCAGGGACGCGCGCTGGCCGTGCTGCTGTCCGGCACGACGGTGGCCACGGTCGCCGGCGTCCCCGGCGGGTCACTCCTC
GGCACGTGGCTCGGCTGGCGGGCCACGTTCTGGGCCGTCGCCGTCTGCTGCCTGCCCGCGGCGTTCGGCGTGCTGAAGGCAATCCCCGCC
GGACGTGCGACGGCAGCGGCGACCGGTGGGCCGCCGCTGCGAGTCGAGCTCGCCGCGCTCAAGACCCCCCGGTTGCTGCTGGCGATGCTG
CTGGGCGCGCTGGTGAACGCGGCAACCTTCGCGAGCTTCACCTTCCTGGCCCCCGTCGTGACCGACACCGCAGGGCTGGGCGACCTGTGG
ATCTCTGTCGCCCTGGTGCTCTTCGGCGCCGGTTCCTTCGCCGGCGTCACCGTCGCCGGACGACTGTCCGACCGACGCCCCGCCCAGGTG
CTCGCCGTCGCCGGTCCGCTGCTGCTCGTCGGCTGGCCCGCGCTGGCGATGCTGGCCGACCGGCCGGTCGCCCTGCTGACCCTCGTGTTC
GTCCAAGGCGCACTGTCGTTCGCGCTGGGCAGCACGCTGATCACGCGGGTCCTCTACGAGGCGGCGGGAGCACCCACCATGGCCGGTTCG
TACGCGACCGCCGCCCTCAACGTGGGCGCCGCGGCCGGACCGCTCGTCGCCGCGACCACTCTCGGCCACACGACCGGCAACCTCGGGCCG
CTGTGGGCGAGCGGGCTCCTGGTCGCCGTCGCGCTGCTCGTCGCGTTCCCCTTCCGCACGGTGATCACGACGGCCGCACCCGCCGACGCG
ACCCGGTGA