cmlA1

Accession ARO:3002693
DefinitioncmlA1 is a plasmid or transposon-encoded chloramphenicol exporter that is found in Pseudomonas aeruginosa and Klebsiella pneumoniae
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classtetracycline antibiotic, acridine dye, lincosamide antibiotic, isoniazid, macrolide antibiotic, nitroimidazole antibiotic, phenicol antibiotic, peptide antibiotic, bicyclomycin, benzalkonium chloride, fluoroquinolone antibiotic, rhodamine, rifamycin antibiotic, fosfomycin, diaminopyrimidine antibiotic, oxazolidinone antibiotic, nucleoside antibiotic, antibacterial free fatty acids, penam, glycylcycline, cephalosporin
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Classification30 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
Publications

Bissonnette L, et al. 1991. J Bacteriol 173(14): 4493-4502. Characterization of the nonenzymatic chloramphenicol resistance (cmlA) gene of the In4 integron of Tn1696: similarity of the product to transmembrane transport proteins. (PMID 1648560)

Stokes HW and Hall RM. 1991. Plasmid 26(1): 10-19. Sequence analysis of the inducible chloramphenicol resistance determinant in the Tn1696 integron suggests regulation by translational attenuation. (PMID 1658833)

Partridge SR, et al. 2001. Antimicrob Agents Chemother 45(11): 3014-3020. Family of class 1 integrons related to In4 from Tn1696. (PMID 11600350)

Poirel L, et al. 2003. Antimicrob Agents Chemother 47(9): 2938-2945. Insertion sequence ISEcp1B is involved in expression and mobilization of a bla(CTX-M) beta-lactamase gene. (PMID 12936998)

Resistomes

Prevalence of cmlA1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Citrobacter freundii0%0%1.55%
Enterobacter cloacae0%0%0.68%
Enterobacter hormaechei0%0%0.79%
Enterobacter kobei0%0%3.12%
Escherichia coli0%0.32%1.08%
Klebsiella oxytoca0%0%0.93%
Proteus mirabilis4.35%0%0.86%
Pseudomonas putida0%0%1.25%
Salmonella enterica0%1.41%0.23%
Shigella sonnei0%0%0.86%
Yersinia enterocolitica0%0%1.3%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 1000


>gb|AAA26057.1|+|cmlA1 [Pseudomonas aeruginosa] Partial
MSSKNFSWRYSLAATVLLLSPFDLLASLGMDMYLPAVPFMPNALGTTASTIQLTLTTYLVMIGAGQLLFGPLSDRLGRRPVLLGGGLAYV
VASMGLALTSSAEVFLGLRILQACGASACLVSTFATVRDIYAGREESNVIYGILGSMLAMVPAVGPLLGALVDMWLGWRAIFAFLGLGMI
AASAAAWRFWPETRVQRVAGLQWSQLLLPVKCLNFWLYTLCYAAGMGSFFVFFSIAPGLMMGRQGVSQLGFSLLFATVAIAMVFTARFMG
RVIPKWGSPSVLRMGMGCLIAGAVLLAITEIWALQSVLGFIAPMWLVGIGVATAVSVAPNGALRGFDHVAGTVTAVYFCLGGVLLGSIGT
LIISLLPRNTAWPVVVYCLTLATVVLGLSCVSRVKGSRGQGEHDVVALQSAGSTSNPNR


>gb|M64556.1|+|601-1860|cmlA1 [Pseudomonas aeruginosa] Partial
GTGAGCTCAAAAAACTTTAGTTGGCGGTACTCCCTTGCCGCCACGGTGTTGTTGTTATCACCGTTCGATTTATTGGCATCACTCGGCATG
GACATGTACTTGCCAGCAGTGCCGTTTATGCCAAACGCGCTTGGTACGACAGCGAGCACAATTCAGCTTACGCTGACAACGTACTTGGTC
ATGATTGGTGCCGGTCAGCTCTTGTTTGGACCGCTATCGGACCGACTGGGGCGCCGCCCCGTTCTACTGGGAGGTGGCCTCGCCTACGTT
GTGGCGTCAATGGGCCTCGCTCTTACGTCATCGGCTGAAGTCTTTCTGGGGCTTCGGATTCTTCAGGCTTGTGGTGCCTCGGCGTGCCTT
GTTTCCACATTTGCAACAGTACGTGACATTTACGCAGGTCGCGAGGAAAGTAATGTCATTTACGGCATACTCGGATCCATGCTGGCCATG
GTCCCGGCGGTAGGCCCATTGCTCGGAGCGCTCGTCGACATGTGGCTTGGGTGGCGGGCTATCTTTGCGTTTCTAGGTTTGGGCATGATC
GCTGCATCTGCAGCAGCGTGGCGATTCTGGCCTGAAACCCGGGTGCAACGAGTTGCGGGCTTGCAATGGTCGCAGCTGCTACTCCCCGTT
AAGTGCCTGAACTTCTGGTTGTACACGTTGTGTTACGCCGCTGGAATGGGTAGCTTCTTCGTCTTTTTCTCCATTGCGCCCGGACTAATG
ATGGGCAGGCAAGGTGTGTCTCAGCTTGGCTTCAGCCTGCTGTTCGCCACAGTGGCAATTGCCATGGTGTTTACGGCTCGTTTTATGGGG
CGTGTGATACCCAAGTGGGGCAGCCCAAGTGTCTTGCGAATGGGAATGGGATGCCTGATAGCTGGAGCAGTATTGCTTGCCATCACCGAA
ATATGGGCTTTGCAGTCCGTGTTAGGCTTTATTGCTCCAATGTGGCTAGTGGGTATTGGTGTCGCCACAGCGGTATCTGTGGCGCCCAAT
GGCGCTCTTCGAGGATTCGACCATGTTGCTGGAACGGTCACGGCAGTCTACTTCTGCTTGGGCGGTGTACTGCTAGGAAGCATCGGAACG
TTGATCATTTCGCTGTTGCCGCGCAACACGGCTTGGCCGGTTGTCGTGTACTGTTTGACCCTTGCAACAGTCGTGCTCGGTCTGTCTTGT
GTTTCCCGAGTGAAGGGCTCTCGCGGCCAGGGGGAGCATGATGTGGTCGCGCTACAAAGTGCGGGAAGTACATCAAATCCCAATCGTTGA