cmlA4

Accession ARO:3002694
DefinitioncmlA4 is a plasmid-encoded chloramphenicol exporter that is found in Klebsiella pneumoniae
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classtetracycline antibiotic, rifamycin antibiotic, penam, phenicol antibiotic, diaminopyrimidine antibiotic, fluoroquinolone antibiotic, rhodamine, acridine dye, isoniazid, cephalosporin, glycylcycline, nitroimidazole antibiotic, antibacterial free fatty acids, benzalkonium chloride, lincosamide antibiotic, peptide antibiotic, nucleoside antibiotic, bicyclomycin, fosfomycin, oxazolidinone antibiotic, macrolide antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Classification30 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
+ confers_resistance_to_drug_class phenicol antibiotic [Drug Class]
Publications

Poirel L, et al. 2000. Antimicrob Agents Chemother 44(3): 622-632. Biochemical sequence analyses of GES-1, a novel class A extended-spectrum beta-lactamase, and the class 1 integron In52 from Klebsiella pneumoniae. (PMID 10681329)

Resistomes

Prevalence of cmlA4 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii0%0%0.04%
Burkholderia cepacia0%0%12.3%
Citrobacter freundii0%0%0.78%
Enterobacter hormaechei0%0%0.32%
Escherichia coli0%0%0.03%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 1000


>gb|AAF27726.1|+|cmlA4 [Klebsiella pneumoniae]
MRSKNFSWRYSLAATVLLLSPFDLLASLGMDMYLPAVPFMPNALGTTASTVQLTLATYLVMIGAGQLLFGPLSDRLGRRPVLLGGGLAYV
VASMGLAFTSLAEVFLGLRILQACGASACLVSTFATVRDIYAGREESNVIYGILGSMLAMVPAVGPLLGALVDMWLGWRAIFAFLGLGMI
AASAAAWRFWPETRVQRVTGLQWSQLLLPVKCLNFWLYTLCYAAGMGSFFVFFFIAPGLIMGRQGVSQLGFSLLFATVAIAMVFTARFMG
RVIPKWGSPSVLRMGMGCLIAGAVLLAITEIWASQSVLGFIAPMWLVGIGVATAVSVAPNGALQGFDHVAGTVTAVYFCLGGVLLGSIGT
LIISLLPRNTAWPVVVYCLTLATVVLGLSCVSRAKGSRGQGEHDVVALQSAESTSNPNR


>gb|AF156486|+|3649-4908|cmlA4 [Klebsiella pneumoniae]
GTGCGCTCAAAAAACTTTAGTTGGCGGTACTCCCTTGCCGCCACGGTGTTGTTGTTATCACCGTTCGATTTGCTGGCATCACTCGGCATG
GACATGTACTTGCCGGCAGTGCCTTTTATGCCAAACGCGCTTGGCACGACAGCGAGCACAGTTCAGCTTACGCTGGCAACGTACTTGGTC
ATGATCGGTGCCGGTCAGCTCTTGTTTGGACCGCTATCGGACCGACTGGGGCGCCGCCCCGTTCTACTGGGAGGTGGCCTCGCCTACGTT
GTGGCGTCAATGGGCCTCGCTTTTACGTCATTGGCTGAAGTCTTTCTGGGGCTTCGGATTCTTCAGGCTTGTGGTGCCTCGGCGTGCCTT
GTTTCCACGTTTGCAACAGTACGTGACATTTACGCAGGTCGCGAGGAAAGTAACGTCATTTACGGCATACTCGGATCCATGCTGGCCATG
GTCCCGGCGGTAGGCCCATTGCTCGGAGCGCTCGTCGACATGTGGCTTGGGTGGCGGGCTATCTTTGCGTTTCTAGGTTTGGGCATGATC
GCTGCATCTGCAGCAGCGTGGCGATTCTGGCCAGAAACCCGGGTGCAACGAGTTACGGGCTTGCAATGGTCGCAGCTGCTACTCCCCGTT
AAGTGCCTGAACTTCTGGTTGTACACGTTGTGTTACGCCGCTGGAATGGGTAGCTTCTTCGTCTTTTTCTTCATTGCGCCCGGACTAATA
ATGGGCAGGCAAGGTGTGTCTCAGCTTGGCTTCAGCCTGCTGTTTGCCACAGTGGCAATTGCCATGGTGTTTACGGCTCGTTTTATGGGG
CGTGTGATACCCAAGTGGGGCAGCCCAAGTGTCTTGCGAATGGGAATGGGATGCCTGATAGCTGGAGCAGTATTGCTTGCCATCACCGAA
ATATGGGCTTCGCAGTCCGTGTTAGGCTTTATTGCTCCGATGTGGCTAGTGGGTATTGGTGTCGCCACAGCGGTATCTGTGGCACCCAAT
GGCGCTCTTCAAGGATTCGACCATGTTGCTGGAACGGTCACGGCAGTTTACTTCTGCTTGGGCGGTGTACTGCTAGGAAGCATCGGAACG
TTGATCATTTCGCTGTTGCCGCGCAACACGGCTTGGCCGGTTGTCGTGTACTGTTTGACCCTTGCAACAGTCGTGCTCGGTCTGTCTTGT
GTTTCCCGAGCGAAGGGCTCTCGCGGCCAGGGGGAGCATGATGTGGTCGCGCTACAAAGTGCGGAAAGTACGTCAAATCCCAATCGTTGA