cmlA5

Download Sequences

Accession	ARO:3002695
Synonym(s)	cmlA7
CARD Short Name	cmlA5
Definition	cmlA5 is a plasmid or transposon-encoded chloramphenicol exporter that is found in Escherichia coli.
AMR Gene Family	major facilitator superfamily (MFS) antibiotic efflux pump
Drug Class	phenicol antibiotic
Resistance Mechanism	antibiotic efflux
Efflux Component	efflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect Matches	Acinetobacter baumannii^g+p+wgs+gi, Aeromonas caviae^g+wgs+gi, Aeromonas hydrophila^g+p, Aeromonas veronii^g+wgs, Citrobacter freundii^p+wgs, Citrobacter koseri^wgs, Citrobacter portucalensis^wgs, Citrobacter werkmanii^wgs, Citrobacter youngae^wgs, Enterobacter cloacae^wgs, Enterobacter hormaechei^wgs, Escherichia albertii^wgs, Escherichia coli^g+p+wgs, Escherichia fergusonii^p+wgs, Klebsiella aerogenes^wgs, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^p+wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^p+wgs, Proteus mirabilis^p+wgs, Proteus vulgaris^wgs, Providencia rettgeri^wgs, Providencia stuartii^p+wgs, Pseudomonas aeruginosa^g+p+wgs+gi, Pseudomonas putida^p, Pseudomonas stutzeri^wgs, Salmonella enterica^p+wgs, Serratia marcescens^wgs, Shigella flexneri^p, Stenotrophomonas maltophilia^wgs, Vibrio alginolyticus^wgs, Vibrio cholerae^wgs, Vibrio parahaemolyticus^wgs
Resistomes with Sequence Variants	Acinetobacter baumannii^g+p+wgs+gi, Acinetobacter nosocomialis^wgs, Acinetobacter pittii^wgs, Aeromonas caviae^g+wgs+gi, Aeromonas hydrophila^g+p+wgs, Aeromonas veronii^g+wgs, Citrobacter freundii^p+wgs, Citrobacter koseri^wgs, Citrobacter portucalensis^wgs, Citrobacter werkmanii^wgs, Citrobacter youngae^wgs, Enterobacter cloacae^wgs, Enterobacter hormaechei^wgs, Escherichia albertii^wgs, Escherichia coli^g+p+wgs+gi, Escherichia fergusonii^p+wgs, Klebsiella aerogenes^wgs, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^p+wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^p+wgs, Laribacter hongkongensis^wgs, Proteus mirabilis^p+wgs, Proteus vulgaris^wgs, Providencia rettgeri^wgs, Providencia stuartii^p+wgs, Pseudomonas aeruginosa^g+p+wgs+gi, Pseudomonas mendocina^g, Pseudomonas monteilii^g+gi, Pseudomonas putida^p+wgs, Pseudomonas stutzeri^wgs, Salmonella enterica^p+wgs+gi, Serratia marcescens^wgs, Shigella flexneri^p, Shigella sonnei^wgs, Stenotrophomonas maltophilia^wgs, Vibrio alginolyticus^wgs, Vibrio cholerae^wgs, Vibrio parahaemolyticus^wgs
Classification	7 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic molecule + antibiotic efflux [Resistance Mechanism] + phenicol antibiotic [Drug Class] + efflux pump complex or subunit conferring antibiotic resistance [Efflux Component]
Parent Term(s)	2 ontology terms \| Show + major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family] + confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
Publications	Poirel L, et al. 1999. Antimicrob Agents Chemother 43(3): 573-581. Molecular and biochemical characterization of VEB-1, a novel class A extended-spectrum beta-lactamase encoded by an Escherichia coli integron gene. (PMID 10049269) Tennstedt T, et al. 2003. FEMS Microbiol Ecol 45(3): 239-252. Occurrence of integron-associated resistance gene cassettes located on antibiotic resistance plasmids isolated from a wastewater treatment plant. (PMID 19719593)

Resistomes

Prevalence of cmlA5 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Acinetobacter baumannii	1.42%	0.94%	3.4%	1.89%	0%
Acinetobacter baumannii	1.24%	0.94%	2.93%	1.89%	0%
Acinetobacter nosocomialis	0%	0%	0.57%	0%	0%
Acinetobacter nosocomialis	0%	0%	0%	0%	0%
Acinetobacter pittii	0%	0%	0%	0%	0%
Acinetobacter pittii	0%	0%	0.85%	0%	0%
Aeromonas caviae	2.27%	0%	1.08%	33.33%	0%
Aeromonas caviae	2.27%	0%	1.61%	33.33%	0%
Aeromonas hydrophila	3.08%	2.6%	0%	0%	0%
Aeromonas hydrophila	3.08%	2.6%	0.81%	0%	0%
Aeromonas veronii	3.64%	0%	2.25%	0%	0%
Aeromonas veronii	5.45%	0%	2.25%	0%	0%
Citrobacter freundii	0%	0.31%	2.32%	0%	0%
Citrobacter freundii	0%	0.31%	2.13%	0%	0%
Citrobacter koseri	0%	0%	0.9%	0%	0%
Citrobacter koseri	0%	0%	0.9%	0%	0%
Citrobacter portucalensis	0%	0%	2.7%	0%	0%
Citrobacter portucalensis	0%	0%	2.7%	0%	0%
Citrobacter werkmanii	0%	0%	5.13%	0%	0%
Citrobacter werkmanii	0%	0%	5.13%	0%	0%
Citrobacter youngae	0%	0%	6.25%	0%	0%
Citrobacter youngae	0%	0%	6.25%	0%	0%
Enterobacter cloacae	0%	0%	0.96%	0%	0%
Enterobacter cloacae	0%	0%	0.96%	0%	0%
Enterobacter hormaechei	0%	0%	1.34%	0%	0%
Enterobacter hormaechei	0%	0%	1.04%	0%	0%
Escherichia albertii	0%	0%	0.65%	0%	0%
Escherichia albertii	0%	0%	0.65%	0%	0%
Escherichia coli	0.05%	0.39%	1.01%	0.26%	0.13%
Escherichia coli	0.02%	0.26%	0.71%	0%	0.09%
Escherichia fergusonii	0%	0.71%	1.09%	0%	0%
Escherichia fergusonii	0%	0.71%	1.09%	0%	0%
Klebsiella aerogenes	0%	0%	0.28%	0%	0%
Klebsiella aerogenes	0%	0%	0.28%	0%	0%
Klebsiella michiganensis	0%	0.57%	0.53%	0%	0%
Klebsiella michiganensis	0%	0.57%	0.53%	0%	0%
Klebsiella oxytoca	0%	0.68%	0.84%	0%	0%
Klebsiella oxytoca	0%	0.68%	0.84%	0%	0%
Klebsiella pneumoniae	0%	0.67%	2.12%	0%	0%
Klebsiella pneumoniae	0%	0.7%	2.19%	0%	0%
Klebsiella quasipneumoniae	0%	0.42%	5.79%	0%	0%
Klebsiella quasipneumoniae	0%	0.42%	6.18%	0%	0%
Laribacter hongkongensis	0%	0%	6.25%	0%	0%
Laribacter hongkongensis	0%	0%	0%	0%	0%
Proteus mirabilis	0%	2.5%	0.99%	0%	0%
Proteus mirabilis	0%	2.5%	0.5%	0%	0%
Proteus vulgaris	0%	0%	5.56%	0%	0%
Proteus vulgaris	0%	0%	5.56%	0%	0%
Providencia rettgeri	0%	0%	15.29%	0%	0%
Providencia rettgeri	0%	0%	15.29%	0%	0%
Providencia stuartii	0%	11.36%	6.82%	0%	0%
Providencia stuartii	0%	13.64%	6.82%	0%	0%
Pseudomonas aeruginosa	1.07%	0.29%	1.54%	4.17%	0%
Pseudomonas aeruginosa	2.3%	1.75%	1.8%	6.94%	0%
Pseudomonas mendocina	0%	0%	0%	0%	0%
Pseudomonas mendocina	12.5%	0%	0%	0%	0%
Pseudomonas monteilii	22.22%	0%	0%	100%	0%
Pseudomonas monteilii	0%	0%	0%	0%	0%
Pseudomonas putida	0%	8%	1.07%	0%	0%
Pseudomonas putida	0%	8%	0%	0%	0%
Pseudomonas stutzeri	0%	0%	5.34%	0%	0%
Pseudomonas stutzeri	0%	0%	6.87%	0%	0%
Salmonella enterica	0%	0.33%	0.49%	0%	0%
Salmonella enterica	0%	0.33%	0.5%	0.33%	0%
Serratia marcescens	0%	0%	0.66%	0%	0%
Serratia marcescens	0%	0%	0.66%	0%	0%
Shigella flexneri	0%	0.4%	0%	0%	0%
Shigella flexneri	0%	0.4%	0%	0%	0%
Shigella sonnei	0%	0%	0.07%	0%	0%
Shigella sonnei	0%	0%	0%	0%	0%
Stenotrophomonas maltophilia	0%	0%	0.15%	0%	0%
Stenotrophomonas maltophilia	0%	0%	0.15%	0%	0%
Vibrio alginolyticus	0%	0%	0.4%	0%	0%
Vibrio alginolyticus	0%	0%	0.4%	0%	0%
Vibrio cholerae	0%	0%	0.32%	0%	0%
Vibrio cholerae	0%	0%	0.32%	0%	0%
Vibrio parahaemolyticus	0%	0%	0.1%	0%	0%
Vibrio parahaemolyticus	0%	0%	0.1%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 750

Protein
DNA

>gb|AAM77075.1|+|cmlA5 [uncultured bacterium]
MRSKNFSWRYSLAATVLLLSPFDLLASLGMDMYLPAVPFMPNALGTTASTIQLTLTTYLVMIGAGQLLFGPLSDRLGRRPVLLGGGLAYV
VASMGLALTSSAEVFLGLRILQACGASACLVSTFATVRDIYAGREESNVIYGILGSMLAMVPAVGPLLGALVDMWLGWRAIFAFLGLGMI
AASAAAWRFWPETRVQRVAGLQWSQLLLPVKCLNFWLYTLCYAAGMGSFFVFFSIAPGLMMGRQGVSQLGFSLLFATVAIAMVFTARFMG
RVIPKWGSPSVLRMGMGCLIAGAVLLAITEIWASQSVLGFIAPMWLVGIGVATAVSVSPNGALRGFDHVAGTVTAVYFCLGGVLLGSIGT
LIISLLPRNTAWPVVVYCLTLATVVLGLSCVSRVKGSRGQGEHDVVALQSAESTSNPNR

>gb|AY115475.1|+|3338-4597|cmlA5 [uncultured bacterium]
GTGCGCTCAAAAAACTTTAGTTGGCGGTACTCCCTTGCCGCCACGGTGTTGTTGTTATCACCGTTCGATTTATTGGCATCACTCGGCATG
GACATGTACTTGCCAGCAGTGCCGTTTATGCCAAACGCGCTTGGTACGACAGCGAGCACAATTCAGCTTACGCTGACAACGTACTTGGTC
ATGATTGGTGCCGGTCAGCTCTTGTTTGGACCGCTATCGGACCGACTGGGGCGCCGCCCCGTTCTACTGGGAGGTGGCCTCGCCTACGTT
GTGGCGTCAATGGGCCTCGCTCTTACGTCATCGGCTGAAGTCTTTCTGGGGCTTCGGATTCTTCAGGCTTGTGGTGCCTCGGCGTGCCTT
GTTTCCACATTTGCAACAGTACGTGACATTTACGCAGGTCGCGAGGAAAGTAATGTCATTTACGGCATACTCGGATCCATGCTGGCCATG
GTCCCGGCGGTAGGCCCATTGCTCGGAGCGCTCGTCGACATGTGGCTTGGGTGGCGGGCTATCTTTGCGTTTCTAGGTTTGGGCATGATC
GCTGCATCTGCAGCAGCGTGGCGATTCTGGCCTGAAACCCGGGTGCAACGAGTTGCGGGCTTGCAATGGTCGCAGCTGCTACTCCCCGTT
AAGTGCCTGAACTTCTGGTTGTACACGTTGTGTTACGCCGCTGGAATGGGTAGCTTCTTCGTCTTTTTCTCCATTGCGCCCGGACTAATG
ATGGGCAGGCAAGGTGTGTCTCAGCTTGGCTTCAGCCTGCTGTTCGCCACAGTGGCAATTGCCATGGTGTTTACGGCTCGTTTTATGGGG
CGTGTGATACCCAAGTGGGGCAGCCCAAGTGTCTTGCGAATGGGAATGGGATGCCTGATAGCTGGAGCAGTATTGCTTGCCATCACCGAA
ATATGGGCTTCGCAGTCCGTGTTAGGCTTTATTGCTCCAATGTGGCTAGTGGGTATTGGTGTCGCCACAGCGGTATCTGTGTCGCCCAAT
GGCGCTCTTCGAGGATTCGACCATGTTGCTGGAACGGTCACGGCAGTCTACTTCTGCTTGGGCGGTGTACTGCTAGGAAGCATCGGAACG
TTGATCATTTCGCTGTTGCCGCGCAACACGGCTTGGCCGGTTGTCGTGTACTGTTTGACCCTTGCAACAGTCGTGCTCGGTCTGTCTTGT
GTTTCCCGAGTGAAGGGCTCTCGCGGCCAGGGGGAGCATGATGTGGTCGCGCTACAAAGTGCGGAAAGTACATCAAATCCCAATCGTTGA

Curator Acknowledgements

Curator	Description	Most Recent Edit

cmlA5

Prevalence: protein homolog model (view sequences)

Graph