cmlA5

Accession ARO:3002695
Synonym(s)cmlA7
DefinitioncmlA5 is a plasmid or transposon-encoded chloramphenicol exporter that is found in Escherichia coli
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classtetracycline antibiotic, acridine dye, fluoroquinolone antibiotic, nucleoside antibiotic, penam, oxazolidinone antibiotic, isoniazid, glycylcycline, antibacterial free fatty acids, benzalkonium chloride, diaminopyrimidine antibiotic, cephalosporin, lincosamide antibiotic, peptide antibiotic, bicyclomycin, rhodamine, phenicol antibiotic, rifamycin antibiotic, fosfomycin, nitroimidazole antibiotic, macrolide antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesAcinetobacter baumanniig+p+wgs, Citrobacter freundiip+wgs, Enterobacter cloacaewgs, Enterobacter hormaecheiwgs, Escherichia colip+wgs, Klebsiella oxytocawgs, Proteus mirabilisp+wgs, Proteus vulgariswgs, Providencia rettgeriwgs, Providencia stuartiiwgs, Pseudomonas putidap, Pseudomonas stutzeriwgs, Salmonella entericap+wgs, Vibrio choleraewgs
Classification30 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
Publications

Poirel L, et al. 1999. Antimicrob Agents Chemother 43(3): 573-581. Molecular and biochemical characterization of VEB-1, a novel class A extended-spectrum beta-lactamase encoded by an Escherichia coli integron gene. (PMID 10049269)

Tennstedt T, et al. 2003. FEMS Microbiol Ecol 45(3): 239-252. Occurrence of integron-associated resistance gene cassettes located on antibiotic resistance plasmids isolated from a wastewater treatment plant. (PMID 19719593)

Resistomes

Prevalence of cmlA5 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii2.55%2.33%1.41%
Acinetobacter nosocomialis0%0%2%
Citrobacter freundii0%1.16%3.1%
Enterobacter asburiae0%0%4.69%
Enterobacter cloacae0%0%3.16%
Enterobacter hormaechei0%0.9%1.27%
Escherichia coli0%0.16%0.11%
Klebsiella oxytoca0%0%4.67%
Klebsiella pneumoniae0%0%0%
Proteus mirabilis0%7.41%1.72%
Proteus vulgaris0%0%12.5%
Providencia rettgeri0%0%7.69%
Providencia stuartii0%0%15.38%
Pseudomonas putida0%10%0%
Pseudomonas stutzeri0%0%11.94%
Ralstonia pickettii0%0%0%
Salmonella enterica0%0.35%0.25%
Vibrio cholerae0%0%0.22%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 1000


>gb|AAM77075.1|+|cmlA5 [uncultured bacterium]
MRSKNFSWRYSLAATVLLLSPFDLLASLGMDMYLPAVPFMPNALGTTASTIQLTLTTYLVMIGAGQLLFGPLSDRLGRRPVLLGGGLAYV
VASMGLALTSSAEVFLGLRILQACGASACLVSTFATVRDIYAGREESNVIYGILGSMLAMVPAVGPLLGALVDMWLGWRAIFAFLGLGMI
AASAAAWRFWPETRVQRVAGLQWSQLLLPVKCLNFWLYTLCYAAGMGSFFVFFSIAPGLMMGRQGVSQLGFSLLFATVAIAMVFTARFMG
RVIPKWGSPSVLRMGMGCLIAGAVLLAITEIWASQSVLGFIAPMWLVGIGVATAVSVSPNGALRGFDHVAGTVTAVYFCLGGVLLGSIGT
LIISLLPRNTAWPVVVYCLTLATVVLGLSCVSRVKGSRGQGEHDVVALQSAESTSNPNR


>gb|AY115475|+|3338-4597|cmlA5 [uncultured bacterium]
GTGCGCTCAAAAAACTTTAGTTGGCGGTACTCCCTTGCCGCCACGGTGTTGTTGTTATCACCGTTCGATTTATTGGCATCACTCGGCATG
GACATGTACTTGCCAGCAGTGCCGTTTATGCCAAACGCGCTTGGTACGACAGCGAGCACAATTCAGCTTACGCTGACAACGTACTTGGTC
ATGATTGGTGCCGGTCAGCTCTTGTTTGGACCGCTATCGGACCGACTGGGGCGCCGCCCCGTTCTACTGGGAGGTGGCCTCGCCTACGTT
GTGGCGTCAATGGGCCTCGCTCTTACGTCATCGGCTGAAGTCTTTCTGGGGCTTCGGATTCTTCAGGCTTGTGGTGCCTCGGCGTGCCTT
GTTTCCACATTTGCAACAGTACGTGACATTTACGCAGGTCGCGAGGAAAGTAATGTCATTTACGGCATACTCGGATCCATGCTGGCCATG
GTCCCGGCGGTAGGCCCATTGCTCGGAGCGCTCGTCGACATGTGGCTTGGGTGGCGGGCTATCTTTGCGTTTCTAGGTTTGGGCATGATC
GCTGCATCTGCAGCAGCGTGGCGATTCTGGCCTGAAACCCGGGTGCAACGAGTTGCGGGCTTGCAATGGTCGCAGCTGCTACTCCCCGTT
AAGTGCCTGAACTTCTGGTTGTACACGTTGTGTTACGCCGCTGGAATGGGTAGCTTCTTCGTCTTTTTCTCCATTGCGCCCGGACTAATG
ATGGGCAGGCAAGGTGTGTCTCAGCTTGGCTTCAGCCTGCTGTTCGCCACAGTGGCAATTGCCATGGTGTTTACGGCTCGTTTTATGGGG
CGTGTGATACCCAAGTGGGGCAGCCCAAGTGTCTTGCGAATGGGAATGGGATGCCTGATAGCTGGAGCAGTATTGCTTGCCATCACCGAA
ATATGGGCTTCGCAGTCCGTGTTAGGCTTTATTGCTCCAATGTGGCTAGTGGGTATTGGTGTCGCCACAGCGGTATCTGTGTCGCCCAAT
GGCGCTCTTCGAGGATTCGACCATGTTGCTGGAACGGTCACGGCAGTCTACTTCTGCTTGGGCGGTGTACTGCTAGGAAGCATCGGAACG
TTGATCATTTCGCTGTTGCCGCGCAACACGGCTTGGCCGGTTGTCGTGTACTGTTTGACCCTTGCAACAGTCGTGCTCGGTCTGTCTTGT
GTTTCCCGAGTGAAGGGCTCTCGCGGCCAGGGGGAGCATGATGTGGTCGCGCTACAAAGTGCGGAAAGTACATCAAATCCCAATCGTTGA