cmlA5

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002695
Synonym(s)cmlA7
CARD Short NamecmlA5
DefinitioncmlA5 is a plasmid or transposon-encoded chloramphenicol exporter that is found in Escherichia coli.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classphenicol antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONPseudomonas aeruginosa (3)
GAZ
FOODON
ENVO
UBERON
Classification7 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
Resistomes with Perfect MatchesAcinetobacter baumanniig+p+wgs+gi, Aeromonas caviaeg+wgs+gi, Aeromonas hydrophilag+p, Aeromonas veroniig+wgs, Citrobacter freundiip+wgs, Citrobacter koseriwgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Enterobacter cloacaewgs, Enterobacter hormaecheiwgs, Escherichia albertiiwgs, Escherichia colig+p+wgs, Escherichia fergusoniip+wgs, Klebsiella aerogeneswgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep+wgs, Proteus mirabilisp+wgs, Proteus vulgariswgs, Providencia rettgeriwgs, Providencia stuartiip+wgs, Pseudomonas aeruginosag+p+wgs+gi, Pseudomonas putidap, Salmonella entericap+wgs, Serratia marcescenswgs, Shigella flexnerip, Stenotrophomonas maltophiliawgs, Stutzerimonas stutzeriwgs, Vibrio alginolyticuswgs, Vibrio choleraewgs, Vibrio parahaemolyticuswgs
Resistomes with Sequence VariantsAcinetobacter baumanniig+p+wgs+gi, Acinetobacter nosocomialiswgs, Acinetobacter pittiiwgs, Aeromonas caviaeg+wgs+gi, Aeromonas hydrophilag+p+wgs, Aeromonas veroniig+wgs, Citrobacter freundiip+wgs, Citrobacter koseriwgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Ectopseudomonas mendocinag, Enterobacter cloacaewgs, Enterobacter hormaecheiwgs, Escherichia albertiiwgs, Escherichia colig+p+wgs+gi, Escherichia fergusoniip+wgs, Klebsiella aerogeneswgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep+wgs, Laribacter hongkongensiswgs, Proteus mirabilisp+wgs, Proteus vulgariswgs, Providencia rettgeriwgs, Providencia stuartiip+wgs, Pseudomonas aeruginosag+p+wgs+gi, Pseudomonas monteiliig+gi, Pseudomonas putidap+wgs, Salmonella entericap+wgs+gi, Serratia marcescenswgs, Shigella flexnerip, Shigella sonneiwgs, Stenotrophomonas maltophiliawgs, Stutzerimonas stutzeriwgs, Vibrio alginolyticuswgs, Vibrio choleraewgs, Vibrio parahaemolyticuswgs
Publications

Poirel L, et al. 1999. Antimicrob Agents Chemother 43(3): 573-581. Molecular and biochemical characterization of VEB-1, a novel class A extended-spectrum beta-lactamase encoded by an Escherichia coli integron gene. (PMID 10049269)

Tennstedt T, et al. 2003. FEMS Microbiol Ecol 45(3): 239-252. Occurrence of integron-associated resistance gene cassettes located on antibiotic resistance plasmids isolated from a wastewater treatment plant. (PMID 19719593)

Resistomes

Prevalence of cmlA5 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii1.42%0.94%3.4%1.89%0%
Acinetobacter nosocomialis0%0%0.57%0%0%
Acinetobacter pittii0%0%0.85%0%0%
Aeromonas caviae2.27%0%1.61%33.33%0%
Aeromonas hydrophila3.08%2.6%0.81%0%0%
Aeromonas veronii5.45%0%2.25%0%0%
Citrobacter freundii0%0.31%2.32%0%0%
Citrobacter koseri0%0%0.9%0%0%
Citrobacter portucalensis0%0%2.7%0%0%
Citrobacter werkmanii0%0%5.13%0%0%
Citrobacter youngae0%0%6.25%0%0%
Ectopseudomonas mendocina12.5%0%0%0%0%
Enterobacter cloacae0%0%0.96%0%0%
Enterobacter hormaechei0%0%1.34%0%0%
Escherichia albertii0%0%0.65%0%0%
Escherichia coli0.05%0.39%1.01%0.26%0.13%
Escherichia fergusonii0%0.71%1.09%0%0%
Klebsiella aerogenes0%0%0.28%0%0%
Klebsiella michiganensis0%0.57%0.53%0%0%
Klebsiella oxytoca0%0.68%0.84%0%0%
Klebsiella pneumoniae0%0.7%2.19%0%0%
Klebsiella quasipneumoniae0%0.42%6.18%0%0%
Laribacter hongkongensis0%0%6.25%0%0%
Proteus mirabilis0%2.5%0.99%0%0%
Proteus vulgaris0%0%5.56%0%0%
Providencia rettgeri0%0%15.29%0%0%
Providencia stuartii0%13.64%6.82%0%0%
Pseudomonas aeruginosa2.3%1.75%1.8%6.94%0%
Pseudomonas monteilii22.22%0%0%100%0%
Pseudomonas putida0%8%1.07%0%0%
Salmonella enterica0%0.33%0.5%0.33%0%
Serratia marcescens0%0%0.66%0%0%
Shigella flexneri0%0.4%0%0%0%
Shigella sonnei0%0%0.07%0%0%
Stenotrophomonas maltophilia0%0%0.15%0%0%
Stutzerimonas stutzeri0%0%6.87%0%0%
Vibrio alginolyticus0%0%0.4%0%0%
Vibrio cholerae0%0%0.32%0%0%
Vibrio parahaemolyticus0%0%0.1%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 750


>gb|AAM77075.1|+|cmlA5 [uncultured bacterium]
MRSKNFSWRYSLAATVLLLSPFDLLASLGMDMYLPAVPFMPNALGTTASTIQLTLTTYLVMIGAGQLLFGPLSDRLGRRPVLLGGGLAYV
VASMGLALTSSAEVFLGLRILQACGASACLVSTFATVRDIYAGREESNVIYGILGSMLAMVPAVGPLLGALVDMWLGWRAIFAFLGLGMI
AASAAAWRFWPETRVQRVAGLQWSQLLLPVKCLNFWLYTLCYAAGMGSFFVFFSIAPGLMMGRQGVSQLGFSLLFATVAIAMVFTARFMG
RVIPKWGSPSVLRMGMGCLIAGAVLLAITEIWASQSVLGFIAPMWLVGIGVATAVSVSPNGALRGFDHVAGTVTAVYFCLGGVLLGSIGT
LIISLLPRNTAWPVVVYCLTLATVVLGLSCVSRVKGSRGQGEHDVVALQSAESTSNPNR


>gb|AY115475.1|+|3338-4597|cmlA5 [uncultured bacterium]
GTGCGCTCAAAAAACTTTAGTTGGCGGTACTCCCTTGCCGCCACGGTGTTGTTGTTATCACCGTTCGATTTATTGGCATCACTCGGCATG
GACATGTACTTGCCAGCAGTGCCGTTTATGCCAAACGCGCTTGGTACGACAGCGAGCACAATTCAGCTTACGCTGACAACGTACTTGGTC
ATGATTGGTGCCGGTCAGCTCTTGTTTGGACCGCTATCGGACCGACTGGGGCGCCGCCCCGTTCTACTGGGAGGTGGCCTCGCCTACGTT
GTGGCGTCAATGGGCCTCGCTCTTACGTCATCGGCTGAAGTCTTTCTGGGGCTTCGGATTCTTCAGGCTTGTGGTGCCTCGGCGTGCCTT
GTTTCCACATTTGCAACAGTACGTGACATTTACGCAGGTCGCGAGGAAAGTAATGTCATTTACGGCATACTCGGATCCATGCTGGCCATG
GTCCCGGCGGTAGGCCCATTGCTCGGAGCGCTCGTCGACATGTGGCTTGGGTGGCGGGCTATCTTTGCGTTTCTAGGTTTGGGCATGATC
GCTGCATCTGCAGCAGCGTGGCGATTCTGGCCTGAAACCCGGGTGCAACGAGTTGCGGGCTTGCAATGGTCGCAGCTGCTACTCCCCGTT
AAGTGCCTGAACTTCTGGTTGTACACGTTGTGTTACGCCGCTGGAATGGGTAGCTTCTTCGTCTTTTTCTCCATTGCGCCCGGACTAATG
ATGGGCAGGCAAGGTGTGTCTCAGCTTGGCTTCAGCCTGCTGTTCGCCACAGTGGCAATTGCCATGGTGTTTACGGCTCGTTTTATGGGG
CGTGTGATACCCAAGTGGGGCAGCCCAAGTGTCTTGCGAATGGGAATGGGATGCCTGATAGCTGGAGCAGTATTGCTTGCCATCACCGAA
ATATGGGCTTCGCAGTCCGTGTTAGGCTTTATTGCTCCAATGTGGCTAGTGGGTATTGGTGTCGCCACAGCGGTATCTGTGTCGCCCAAT
GGCGCTCTTCGAGGATTCGACCATGTTGCTGGAACGGTCACGGCAGTCTACTTCTGCTTGGGCGGTGTACTGCTAGGAAGCATCGGAACG
TTGATCATTTCGCTGTTGCCGCGCAACACGGCTTGGCCGGTTGTCGTGTACTGTTTGACCCTTGCAACAGTCGTGCTCGGTCTGTCTTGT
GTTTCCCGAGTGAAGGGCTCTCGCGGCCAGGGGGAGCATGATGTGGTCGCGCTACAAAGTGCGGAAAGTACATCAAATCCCAATCGTTGA

Curator Acknowledgements
Curator Description Most Recent Edit