cmlA6

Download Sequences

Accession	ARO:3002696
CARD Short Name	cmlA6
Definition	cmlA6 is a plasmid-encoded chloramphenicol exporter that is found in Pseudomonas aeruginosa.
AMR Gene Family	major facilitator superfamily (MFS) antibiotic efflux pump
Drug Class	phenicol antibiotic
Resistance Mechanism	antibiotic efflux
Efflux Component	efflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect Matches	Acinetobacter baumannii^wgs, Acinetobacter indicus^g, Acinetobacter towneri^g+gi, Aeromonas hydrophila^wgs, Bordetella trematum^g+gi, Burkholderia vietnamiensis^wgs, Citrobacter freundii^wgs, Comamonas testosteroni^g, Enterobacter hormaechei^wgs, Escherichia coli^g+p+wgs, Klebsiella pneumoniae^wgs, Morganella morganii^g+wgs, Proteus mirabilis^g+wgs, Proteus vulgaris^wgs, Pseudomonas aeruginosa^g+p+wgs+gi, Pseudomonas putida^g+wgs, Salmonella enterica^p+wgs
Resistomes with Sequence Variants	Acinetobacter baumannii^wgs, Acinetobacter indicus^g, Acinetobacter towneri^g+gi, Aeromonas hydrophila^p+wgs, Bordetella trematum^g+gi, Burkholderia vietnamiensis^wgs, Citrobacter freundii^wgs, Comamonas testosteroni^g, Enterobacter cloacae^wgs, Enterobacter hormaechei^wgs, Escherichia coli^g+p+wgs, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^p+wgs, Klebsiella pneumoniae^p+wgs, Morganella morganii^g+wgs, Proteus mirabilis^g+wgs, Proteus vulgaris^wgs, Providencia rettgeri^wgs, Pseudomonas aeruginosa^g+p+wgs+gi, Pseudomonas putida^g+wgs, Salmonella enterica^p+wgs+gi, Trueperella pyogenes^wgs+gi
Classification	7 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + antibiotic molecule + determinant of antibiotic resistance + antibiotic efflux [Resistance Mechanism] + phenicol antibiotic [Drug Class] + efflux pump complex or subunit conferring antibiotic resistance [Efflux Component]
Parent Term(s)	2 ontology terms \| Show + confers_resistance_to_antibiotic chloramphenicol [Antibiotic] + major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
Publications	Aubert D, et al. 2001. Antimicrob Agents Chemother 45(6): 1615-1620. Oxacillinase-mediated resistance to cefepime and susceptibility to ceftazidime in Pseudomonas aeruginosa. (PMID 11353602)

Resistomes

Prevalence of cmlA6 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI
Acinetobacter baumannii	0%	0%	0.12%	0%
Acinetobacter baumannii	0%	0%	0.14%	0%
Acinetobacter indicus	4.76%	0%	0%	0%
Acinetobacter indicus	4.76%	0%	0%	0%
Acinetobacter towneri	12.5%	0%	0%	100%
Acinetobacter towneri	12.5%	0%	0%	100%
Aeromonas hydrophila	0%	0%	0.81%	0%
Aeromonas hydrophila	0%	1.3%	1.61%	0%
Bordetella trematum	20%	0%	0%	50%
Bordetella trematum	20%	0%	0%	50%
Burkholderia vietnamiensis	0%	0%	0.86%	0%
Burkholderia vietnamiensis	0%	0%	0.86%	0%
Citrobacter freundii	0%	0%	0.19%	0%
Citrobacter freundii	0%	0%	1.35%	0%
Comamonas testosteroni	20%	0%	0%	0%
Comamonas testosteroni	20%	0%	0%	0%
Enterobacter cloacae	0%	0%	0%	0%
Enterobacter cloacae	0%	0%	0.96%	0%
Enterobacter hormaechei	0%	0%	0.04%	0%
Enterobacter hormaechei	0%	0%	0.39%	0%
Escherichia coli	0.05%	0.03%	0.18%	0%
Escherichia coli	0.05%	0.05%	0.24%	0%
Klebsiella michiganensis	0%	0%	0%	0%
Klebsiella michiganensis	0%	0.57%	1.06%	0%
Klebsiella oxytoca	0%	0%	0%	0%
Klebsiella oxytoca	0%	0.68%	0.42%	0%
Klebsiella pneumoniae	0%	0%	0.01%	0%
Klebsiella pneumoniae	0%	0.05%	0.1%	0%
Morganella morganii	1.92%	0%	1.23%	0%
Morganella morganii	1.92%	0%	1.23%	0%
Proteus mirabilis	2.75%	0%	0.33%	0%
Proteus mirabilis	2.75%	0%	0.33%	0%
Proteus vulgaris	0%	0%	5.56%	0%
Proteus vulgaris	0%	0%	5.56%	0%
Providencia rettgeri	0%	0%	0%	0%
Providencia rettgeri	0%	0%	0.64%	0%
Pseudomonas aeruginosa	0.92%	0.58%	0.71%	2.78%
Pseudomonas aeruginosa	1.53%	0.58%	0.76%	2.78%
Pseudomonas putida	1.41%	0%	0.53%	0%
Pseudomonas putida	1.41%	0%	0.53%	0%
Salmonella enterica	0%	0.16%	0.03%	0%
Salmonella enterica	0%	0.22%	0.03%	0.33%
Trueperella pyogenes	0%	0%	0%	0%
Trueperella pyogenes	0%	0%	8.33%	10%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 800

Protein
DNA

>gb|AAK52606.1|+|cmlA6 [Pseudomonas aeruginosa]
MRSKNFSWRYSLAATVLLLSPFDLLASLGMDMYLPAVPFMPNALGTTASTIQLTLTTYLVMIGAGQLLFGPLSDRLGRRPVLLGGGLAYV
VASMGLALTSSAEVFLGLRILQACGASACLVSTFATVRDIYAGREESNVIYGILGSMLAIVPAVGPLLGALVDMWLGWRAIFAFLGLGMI
AASAAAWRFWPETRVQRVAGLQWSQLLLPVKCLNFWLYTLCYAAGMGSFFVFFSIAPGLMMGRQGVSQLGFSLLFATVAIAMVFTARFMG
RVIPKWGSPSVLRMGMGCLIAGAVLLAITEIWALQSVLGFIAPMWLVGIGVATAVSVAPNGALRGFDHVAGTVTAVYFCLGGVLLGSIGT
LIISLLPRNTAWPVVVYCLTLATVVLGLSCVSRVKGSRGQGEHDVVALQSAESTSNPNR

>gb|AF294653.1|+|2750-4009|cmlA6 [Pseudomonas aeruginosa]
GTGCGCTCAAAAAACTTTAGTTGGCGGTACTCCCTTGCCGCCACGGTGTTGTTGTTATCACCGTTCGATTTATTGGCATCACTCGGCATG
GACATGTACTTGCCAGCAGTGCCGTTTATGCCAAACGCGCTTGGTACGACAGCGAGCACAATTCAGCTTACGCTGACAACGTACTTGGTC
ATGATTGGTGCCGGTCAGCTCTTGTTTGGACCGCTATCGGACCGACTGGGGCGCCGCCCCGTTCTACTGGGAGGTGGCCTCGCCTACGTT
GTGGCGTCAATGGGCCTCGCTCTTACGTCATCGGCTGAAGTCTTTCTGGGGCTTCGGATTCTTCAGGCTTGTGGTGCCTCGGCGTGCCTT
GTTTCCACATTTGCAACAGTACGTGACATTTACGCAGGTCGCGAGGAAAGTAATGTCATTTACGGCATACTCGGATCCATGCTGGCCATA
GTCCCGGCGGTAGGCCCATTGCTCGGAGCGCTCGTCGACATGTGGCTTGGGTGGCGGGCTATCTTTGCGTTTCTAGGTTTGGGCATGATC
GCTGCATCTGCAGCAGCGTGGCGATTCTGGCCTGAAACCCGGGTGCAACGAGTTGCGGGCTTGCAATGGTCGCAGCTGCTACTCCCCGTT
AAGTGCCTGAACTTCTGGTTGTACACGTTGTGTTACGCCGCTGGAATGGGTAGCTTCTTCGTCTTTTTCTCCATTGCGCCCGGACTAATG
ATGGGCAGGCAAGGTGTGTCTCAGCTTGGCTTCAGCCTGCTGTTCGCCACAGTGGCAATTGCCATGGTGTTTACGGCTCGTTTTATGGGG
CGTGTGATACCCAAGTGGGGCAGCCCAAGTGTCTTGCGAATGGGAATGGGATGCCTGATAGCTGGAGCAGTATTGCTTGCCATCACCGAA
ATATGGGCTTTGCAGTCCGTGTTAGGCTTTATTGCTCCAATGTGGCTAGTGGGTATTGGTGTCGCCACAGCGGTATCTGTGGCGCCCAAT
GGCGCTCTTCGAGGATTCGACCATGTTGCTGGAACGGTCACGGCAGTCTACTTCTGCTTGGGCGGTGTACTGCTAGGAAGCATCGGAACG
TTGATCATTTCGCTGTTGCCGCGCAACACGGCTTGGCCGGTTGTCGTGTACTGTTTGACCCTTGCAACAGTCGTGCTCGGTCTGTCTTGT
GTTTCCCGAGTGAAGGGCTCTCGCGGCCAGGGGGAGCATGATGTGGTCGCGCTACAAAGTGCGGAAAGTACATCAAATCCCAATCGTTGA

cmlA6

Prevalence: protein homolog model (view sequences)

Graph