lmrD

Accession ARO:3002882
Synonym(s)ydbA
DefinitionlmrD is a chromosomally-encoded efflux pump that confers resistance to lincosamides in Streptomyces lincolnensis and Lactococcus lactis. It can dimerize with lmrC
AMR Gene FamilyATP-binding cassette (ABC) antibiotic efflux pump
Drug Classrifamycin antibiotic, peptide antibiotic, acridine dye, cephalosporin, macrolide antibiotic, penam, tetracycline antibiotic, nitroimidazole antibiotic, pleuromutilin antibiotic, fluoroquinolone antibiotic, lincosamide antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Classification18 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_drug_class lincosamide antibiotic [Drug Class]
+ ATP-binding cassette (ABC) antibiotic efflux pump [AMR Gene Family]
Publications

Florez AB, et al. 2006. FEMS Microbiol Lett 263(1): 21-25. Ubiquity and diversity of multidrug resistance genes in Lactococcus lactis strains isolated between 1936 and 1995. (PMID 16958846)

Resistomes

Prevalence of lmrD among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Listeria monocytogenes0%0%0.04%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 1320


>gb|AYV52072.1|+|lmrD [Lactococcus lactis]
MENTKSTRKMSDTTRAIRFFYLYLKRYKLQFAVIMIFIILATWLQVVSPSLLGDAITNLTKYVTDFFTHQHAGQSQDALQQIAQQLSQQM
HQTVDWHNVPEVVKSLPQAAQDQITANLPKGTTLETLKTVATSHAASTSTFMKGMWQLLAVYVATGVSMLIYTLLFSRIVAHSTNRMRKG
LFGKLERLTISYFDRHQDGDILARFTSDLDNIQNTLNQALVSVISNAAVFVGVIIQIFNKDVTFAWLTVAASPVAILSAVIIIRQSKKAT
DKQQEEVSQLNAYMDEKISGQKAIIVEGLQEDSINGFLEHNENVKKRTFAAQAWSGMIFPLMNGFQLLSIAIVIFGGTAYVLNDDSMSIA
TGLGLLVAFVQYVQSYYNPIMQISSNFGQLQLAITGATRLNVMFDEPEEVRPENGKKFDTIKDGIQIENLDFEYLPGKPVLKKVNIDVKK
GQMVALVGPTGSGKTTVMNLMNRFYDVNGGAIKFDGTDIREFDLDSLRSNVGIVLQESVLFDGTIADNIKFGKPNATQEEIETVAKTTHI
HDFIDSLPDKYETHVSDDESVFSVGQKQQISIARTILTNPELLILDEATSNVDTVTEQQIQWAMEAAIAGRTSFVIAHRLKTILNADKIV
VLKDGEVIEEGNHHELVAQGGFYSELYHNQFVFE


>gb|CP033607.1|+|310894-312888|lmrD [Lactococcus lactis]
ATGGAAAATACCAAATCAACAAGAAAAATGTCTGACACCACACGTGCCATCCGATTTTTTTACCTCTATCTGAAAAGATATAAACTCCAA
TTTGCTGTAATTATGATTTTCATCATTTTAGCAACTTGGTTACAGGTTGTTTCTCCATCACTTTTGGGGGACGCCATCACTAATTTGACT
AAATATGTGACTGACTTCTTTACACATCAACATGCTGGTCAATCCCAAGATGCACTACAACAAATTGCTCAACAATTAAGCCAACAAATG
CACCAAACAGTAGATTGGCACAATGTTCCTGAAGTTGTGAAATCTTTGCCACAAGCAGCACAAGACCAAATCACTGCTAATCTTCCTAAA
GGAACAACTTTAGAAACACTTAAAACAGTGGCAACTTCACATGCAGCCAGCACTTCTACATTCATGAAAGGAATGTGGCAATTGCTTGCA
GTCTATGTAGCAACAGGTGTATCAATGTTGATTTATACCTTGCTCTTTAGTCGTATCGTTGCTCATTCAACAAATCGCATGCGTAAAGGT
TTGTTTGGTAAACTTGAACGTTTGACAATTTCATATTTTGACCGTCATCAAGATGGTGATATCCTTGCTCGTTTCACATCTGACTTGGAT
AACATTCAAAATACTTTAAACCAAGCACTCGTTTCGGTTATTTCAAATGCTGCGGTCTTTGTGGGTGTCATTATCCAGATTTTCAATAAA
GATGTGACATTTGCTTGGTTGACAGTTGCTGCTTCTCCAGTTGCCATTTTATCTGCTGTGATTATCATTCGTCAATCGAAAAAAGCAACA
GACAAACAACAAGAAGAAGTTTCACAACTTAATGCCTATATGGATGAAAAAATCTCTGGGCAAAAAGCAATTATCGTTGAAGGTTTACAA
GAAGATTCTATTAATGGATTCTTGGAACACAATGAAAATGTTAAAAAACGTACCTTTGCTGCTCAAGCATGGTCTGGTATGATTTTCCCA
TTGATGAATGGTTTCCAACTTTTATCAATTGCCATTGTTATCTTTGGTGGAACGGCCTATGTTCTTAACGATGATAGCATGTCAATTGCC
ACAGGTTTAGGGCTTTTGGTTGCCTTTGTTCAATACGTTCAAAGTTACTACAACCCAATCATGCAAATTTCATCAAACTTTGGTCAACTT
CAACTTGCCATCACAGGGGCAACTCGTCTGAATGTCATGTTTGATGAACCAGAAGAAGTTCGTCCTGAAAATGGTAAGAAATTTGATACG
ATTAAAGACGGAATTCAAATCGAAAATCTTGATTTTGAATATCTTCCAGGAAAACCAGTCCTCAAAAAAGTTAATATTGATGTTAAAAAA
GGACAAATGGTTGCCCTCGTTGGTCCAACTGGTTCAGGTAAAACAACAGTTATGAACTTGATGAACCGTTTCTACGATGTTAATGGTGGA
GCAATTAAATTTGATGGAACTGATATTCGTGAATTTGATTTAGATAGCTTGCGTTCAAATGTCGGAATTGTTTTGCAAGAGTCTGTTCTC
TTTGATGGAACGATTGCTGATAATATCAAGTTTGGTAAACCAAATGCTACTCAAGAAGAAATTGAAACAGTGGCTAAGACAACTCACATT
CATGATTTCATTGATAGCTTACCTGACAAGTACGAAACACATGTTTCAGATGATGAATCAGTCTTCTCAGTTGGTCAAAAACAACAAATT
TCTATCGCACGTACCATTTTGACAAATCCAGAACTTTTGATTTTGGATGAAGCAACTTCAAATGTGGATACAGTAACTGAACAACAAATT
CAATGGGCGATGGAAGCTGCTATTGCTGGTCGTACTTCATTCGTTATTGCTCACCGTTTGAAAACAATTCTTAATGCAGATAAGATTGTT
GTTCTTAAAGATGGTGAAGTTATCGAAGAAGGAAATCACCATGAACTTGTTGCTCAAGGTGGCTTCTACTCTGAACTTTATCACAATCAA
TTTGTTTTTGAATAA