Escherichia coli nfsB with mutation conferring resistance to nitrofurantoin

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3003756
CARD Short NameEcol_nfsB_NIT
DefinitionnfsB encodes the minor oxygen-insesitive nitroreductase in E. coli. The first step of resistance to nitrofurazone is mutation of nfsA, while the increased resistance associated with second step mutants is a consequence of nfsB mutation.
AMR Gene FamilyAntibiotic resistant nfsB
Drug Classnitrofuran antibiotic
Resistance Mechanismantibiotic target alteration
Classification8 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic nitrofurantoin [Antibiotic]
+ Antibiotic resistant nfsB [AMR Gene Family]
Publications

Whiteway J, et al. 1998. J. Bacteriol. 180(21):5529-39 Oxygen-insensitive nitroreductases: analysis of the roles of nfsA and nfsB in development of resistance to 5-nitrofuran derivatives in Escherichia coli. (PMID 9791100)

Sandegren L, et al. 2008. J. Antimicrob. Chemother. 62(3):495-503 Nitrofurantoin resistance mechanism and fitness cost in Escherichia coli. (PMID 18544599)

Ho PL, et al. 2015. Antimicrob. Agents Chemother. 60(1):537-43 Plasmid-Mediated OqxAB Is an Important Mechanism for Nitrofurantoin Resistance in Escherichia coli. (PMID 26552976)

Resistomes

Prevalence of Escherichia coli nfsB with mutation conferring resistance to nitrofurantoin among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
No prevalence data


Detection Models

Model Type: protein variant model

Model Definition: Protein Variant Models (PVM) perform a similar search as Protein Homolog Models (PHM), i.e. detect protein sequences based on their similarity to a curated reference sequence, but secondarily screen query sequences for curated sets of mutations to differentiate them from antibiotic susceptible wild-type alleles. PVMs are designed to detect AMR acquired via mutation of house-keeping genes or antibiotic targets, e.g. a mutated gyrase resistant to aminocoumarin antibiotics. PVMs include a protein reference sequence (often from antibiotic susceptible wild-type alleles), a curated bit-score cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of single point mutations, insertions, or deletions curated from the scientific literature. A Strict RGI match has a BLASTP bit-score above the curated BLASTP cutoff value and contains at least one curated mutation from amongst the mapped resistance variants, while a Loose RGI match has a bit-score less than the curated BLASTP bit-score cut-off but still contains at least one curated mutation from amongst the mapped resistance variants.

Bit-score Cut-off (blastP): 400

PubMed: mutation data hand curated from the scientific literature, evaluated as conferring resistance (R). CRyPTIC: mutation data acquired from the CRyPTIC catalog, evaluated as resistant (R), susceptible (S), or undetermined (U). ReSeqTB: mutation data acquired from the ReSeqTB catalog, evaluated as conferring resistance (Minimal, Moderate, High), not conferring resistance (None), or Indeterminate. WHO: mutation data acquired from the WHO 2023 catalog, evaluated as resistant (R), susceptible (S), or undetermined (U).

MutationMutation typePubMed
F84Ssingle resistance variantcuration underway
W94Ternonsense mutationcuration underway
E137Ternonsense mutationPMID:26552976
G192Dsingle resistance variantcuration underway
G192Ssingle resistance variantcuration underway

>gb|AAC73679.1|-|Escherichia coli nfsB with mutation conferring resistance to nitrofurantoin [Escherichia coli str. K-12 substr. MG1655]
MDIISVALKRHSTKAFDASKKLTPEQAEQIKTLLQYSPSSTNSQPWHFIVASTEEGKARV
AKSAAGNYVFNERKMLDASHVVVFCAKTAMDDVWLKLVVDQEDADGRFATPEAKAANDKG
RKFFADMHRKDLHDDAEWMAKQVYLNVGNFLLGVAALGLDAVPIEGFDAAILDAEFGLKE
KGYTSLVVVPVGHHSVEDFNATLPKSRLPQNITLTEV



>gb|U00096.3|-|604771-605424|Escherichia coli nfsB with mutation conferring resistance to nitrofurantoin [Escherichia coli str. K-12 substr. MG1655]
ATGGATATCATTTCTGTCGCCTTAAAGCGTCATTCCACTAAGGCATTTGATGCCAGCAAAAAACTTACCCCGGAACAGGCCGAGCAGATC
AAAACGCTACTGCAATACAGCCCATCCAGCACCAACTCCCAGCCGTGGCATTTTATTGTTGCCAGCACGGAAGAAGGTAAAGCGCGTGTT
GCCAAATCCGCTGCCGGTAATTACGTGTTCAACGAGCGTAAAATGCTTGATGCCTCGCACGTCGTGGTGTTCTGTGCAAAAACCGCGATG
GACGATGTCTGGCTGAAGCTGGTTGTTGACCAGGAAGATGCCGATGGCCGCTTTGCCACGCCGGAAGCGAAAGCCGCGAACGATAAAGGT
CGCAAGTTCTTCGCTGATATGCACCGTAAAGATCTGCATGATGATGCAGAGTGGATGGCAAAACAGGTTTATCTCAACGTCGGTAACTTC
CTGCTCGGCGTGGCGGCTCTGGGTCTGGACGCGGTACCCATCGAAGGTTTTGACGCCGCCATCCTCGATGCAGAATTTGGTCTGAAAGAG
AAAGGCTACACCAGTCTGGTGGTTGTTCCGGTAGGTCATCACAGCGTTGAAGATTTTAACGCTACGCTGCCGAAATCTCGTCTGCCGCAA
AACATCACCTTAACCGAAGTGTAA

Curator Acknowledgements
Curator Description Most Recent Edit