Mycolicibacterium smegmatis ndh with mutation conferring resistance to isoniazid

Accession ARO:3003778
DefinitionMutations in the Mycolicibacterium smegmatis ndh gene that results in increased resistance to isoniazid.
AMR Gene Familyantibiotic resistant ndh
Drug Classisoniazid
Resistance Mechanismantibiotic target alteration
Classification10 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic isoniazid [Drug Class]
+ antibiotic resistant ndh [AMR Gene Family]
Publications

Vilch├Ęze C, et al. 2005. Antimicrob. Agents Chemother. 49(2):708-20 Altered NADH/NAD+ ratio mediates coresistance to isoniazid and ethionamide in mycobacteria. (PMID 15673755)

Resistomes

Prevalence of Mycolicibacterium smegmatis ndh with mutation conferring resistance to isoniazid among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
No prevalence data


Detection Models

Model Type: protein variant model

Model Definition: The protein variant model is an AMR detection model. Protein variant models are similar to protein homolog models - they detect the presence of a protein sequence based on its similarity to a curated reference sequence, but secondarily search submitted query sequences for curated sets of mutations shown clinically to confer resistance relative to wild-type. This model includes a protein reference sequence, a curated BLASTP cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of: single resistance variants, insertions, deletions, co-dependent resistance variants, nonsense SNPs, and/or frameshift mutations. Protein variant model matches to reference sequences are categorized on two criteria: strict and loose. A strict match has a BLASTP bitscore above the curated BLASTP cutoff value and contains at least one detected mutation from amongst the mapped resistance variants; a loose match has a BLASTP bitscore below the curated BLASTP cutoff value but still contains at least one detected mutation from amongst the mapped resistance variants. Regardless of BLASTP bitscore, if a sequence does not contain one of the mapped resistance variants, it is not considered a match and not detected by the protein variant model.

Legend:

  • discovered in clinical, agricultural, or environmental isolates
  • discovered via laboratory selection experiments


Bit-score Cut-off (blastP): 800

PMID: 15673755I17T T29P H46P G84D L100P A115T Y122N R145C F170S A187P V246A V272E V300G Q335H Y361H

>gb|AIU22003.1|+|Mycolicibacterium smegmatis mutant ndh conferring resistance to isoniazid [Mycolicibacterium smegmatis]
MSHPGATASDRHKVVIIGSGFGGLTAAKTLKRADVDVKLIARTTHHLFQPLLYQVATGII
SEGEIAPATRVILRKQKNAQVLLCDVTHIDLENKTVDSVLLGHTYSTPYDSLIIAAGAGQ
SYFGNDHFAEFAPGMKSIDDALELRGRILGAFEQAERSSDPVRRAKLLTFTVVGAGPTGV
EMAGQIAELADQTLRGSFRHIDPTEARVILLDAAPAVLPPMGEKLGKKARARLEKMGVEV
QLGAMVTDVDRNGITVKDSDGTIRRIESACKVWSAGVSASPLGKDLAEQSGVELDRAGRV
KVQPDLTLPGHPNVFVVGDMAAVEGVPGVAQGAIQGGRYAAKIIKREVSGTSPKIRTPFE
YFDKGSMATVSRFSAVAKVGPVEFAGFFAWLCWLVLHLVYLVGFKTKIVTLLSWGVTFLS
TKRGQLTITEQQAYARTRIEELEEIAAAVQDTEKAAS



>gb|CP009496.1|+|3684058-3685431|Mycolicibacterium smegmatis mutant ndh conferring resistance to isoniazid [Mycolicibacterium smegmatis]
ATGAGCCATCCCGGAGCTACGGCGTCGGATCGGCATAAAGTCGTCATCATCGGTTCGGGTTTCGGTGGTCTCACCGCTGCCAAGACCCTC
AAGCGCGCTGACGTCGACGTCAAGCTAATCGCCCGTACCACGCACCACCTCTTCCAGCCGCTGCTCTACCAGGTGGCGACCGGCATCATC
TCCGAGGGCGAGATCGCCCCGGCCACTCGAGTGATCCTCCGCAAGCAGAAGAACGCCCAGGTCCTTCTCTGCGATGTGACGCACATCGAT
CTGGAGAACAAGACCGTGGATTCGGTGCTGCTCGGTCACACCTACTCGACGCCCTACGACAGCCTCATCATCGCCGCGGGCGCGGGTCAG
TCCTACTTCGGCAACGACCACTTCGCCGAGTTCGCACCCGGCATGAAGTCGATCGACGATGCGCTGGAGCTGCGCGGTCGCATCCTCGGC
GCGTTCGAACAGGCCGAGCGCTCCAGCGACCCGGTGCGCCGCGCGAAGTTGCTGACGTTCACCGTCGTCGGCGCGGGCCCGACCGGCGTC
GAGATGGCCGGACAGATCGCCGAATTGGCCGACCAGACTTTGCGGGGCAGCTTCCGCCACATCGATCCCACCGAGGCCCGGGTGATCCTG
CTCGACGCCGCACCGGCCGTGCTACCGCCCATGGGCGAGAAGCTCGGCAAGAAGGCGCGGGCCCGTCTGGAGAAGATGGGCGTCGAGGTC
CAGCTGGGTGCGATGGTCACCGACGTCGACCGCAACGGCATCACCGTCAAGGATTCCGACGGGACCATCCGTCGCATCGAGTCGGCGTGC
AAGGTGTGGTCGGCCGGTGTGTCGGCCAGCCCTCTCGGCAAGGATCTCGCCGAGCAGTCGGGTGTCGAACTCGACCGCGCGGGCCGGGTC
AAGGTACAGCCCGACCTGACGCTGCCCGGTCACCCGAACGTGTTCGTCGTGGGCGACATGGCGGCCGTCGAGGGCGTGCCCGGTGTGGCG
CAGGGCGCCATCCAGGGTGGCCGCTACGCCGCGAAGATCATCAAGCGTGAGGTCAGTGGCACCAGCCCGAAGATCCGCACGCCGTTCGAG
TACTTCGACAAGGGCTCGATGGCGACGGTGTCGCGGTTCTCCGCGGTGGCCAAGGTGGGTCCCGTCGAGTTCGCGGGCTTCTTCGCCTGG
TTGTGCTGGCTCGTGCTGCACCTGGTGTACCTGGTCGGGTTCAAGACGAAGATCGTCACACTGCTGTCGTGGGGCGTGACGTTCCTGAGC
ACCAAGCGTGGTCAGCTCACCATCACCGAGCAGCAGGCCTATGCGCGAACCCGCATCGAGGAGCTCGAGGAGATCGCGGCGGCGGTGCAG
GACACCGAGAAAGCCGCGTCCTAG