bcr-1

Accession ARO:3003801
DefinitionTransmembrane protein which expels bicyclomycin from the cell, leading to bicyclomycin resistance. Identified in Pseudomonas aeruginosa strains responsible for outbreaks in Brazil, often appearing with blaSPM-1, another bicyclomycin resistance gene
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classtetracycline antibiotic, cephalosporin, peptide antibiotic, penam, phenicol antibiotic, fluoroquinolone antibiotic, isoniazid, glycylcycline, fosfomycin, nitroimidazole antibiotic, benzalkonium chloride, lincosamide antibiotic, rhodamine, oxazolidinone antibiotic, bicyclomycin, acridine dye, macrolide antibiotic, diaminopyrimidine antibiotic, antibacterial free fatty acids, nucleoside antibiotic, rifamycin antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesPseudomonas fluorescensg
Classification30 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic bicyclomycin [Drug Class]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
Publications

Fonseca EL, et al. 2015. J. Antimicrob. Chemother. 70(9):2547-50 Full characterization of the integrative and conjugative element carrying the metallo-β-lactamase bla SPM-1 and bicyclomycin bcr1 resistance genes found in the pandemic Pseudomonas aeruginosa clone SP/ST277. (PMID 26093374)

Malik M, et al. 2014. J. Antimicrob. Chemother. 69(12):3227-35 Lethal synergy involving bicyclomycin: an approach for reviving old antibiotics. (PMID 25085655)

Resistomes

Prevalence of bcr-1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Escherichia coli0%0%0%
Legionella pneumophila0%0%0.14%
Pseudomonas aeruginosa0%0%0%
Pseudomonas fluorescens3.7%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 500


>gb|ALV80601.1|-|bcr-1 [Pseudomonas aeruginosa]
MPASASRIQVGSGERRLLLLLSALVAFGPLSIDMYLPSLPAIAADLGASDAQVQRSISGFLVGFCVGMLFYGPLSDRFGRRPVLLAGIAL
YLFSSLACALADSAGQLVLLRVLQALGGGAASVLARAMVRDLYPLGEAARMLALMHMVTMLAPLAAPLLGGYLMLWAGWRALFVVLALFA
GLCLLAVWRVAESHPPERRGGSLAQAFLAYGRLLGDRRALGYVLCMGLAFAGMFAYISAAPFVFIEHFGVRAERFGWFFGLNILGVMLAT
WCSARLVRRHGPRPLLRAGSLLACVSGLFLLGYAALGERGGLWALVPGLLCFVSVTGLLGANCIASLLALYPGQAGAASAVAVSGQFGLG
CLASLAVGWLALPGVLPMALVMAVCGVGSLLALGLALHGGNR


>gb|CP012901.1|-|5979157-5980365|bcr-1 [Pseudomonas aeruginosa]
GTGCCTGCGAGTGCATCGAGGATTCAGGTCGGAAGCGGCGAACGACGCCTGTTGCTGCTGTTGTCGGCGCTGGTGGCGTTCGGCCCGCTG
TCGATCGACATGTACCTGCCGAGCCTGCCGGCGATCGCCGCCGATCTCGGCGCCAGCGATGCCCAGGTGCAGCGGAGCATCAGCGGCTTC
CTGGTCGGCTTCTGCGTCGGCATGCTGTTCTACGGCCCCTTGTCCGACCGTTTCGGCCGGCGCCCGGTGCTGCTGGCCGGTATCGCCTTG
TACCTGTTCAGCAGCCTGGCCTGCGCGCTGGCCGACAGCGCGGGGCAACTGGTCCTGCTGAGGGTGCTCCAGGCCCTCGGCGGCGGCGCC
GCGTCGGTGCTGGCGCGGGCCATGGTGCGCGACCTCTATCCGTTGGGCGAGGCCGCCCGGATGCTGGCATTGATGCACATGGTGACCATG
CTGGCACCGCTGGCCGCGCCGCTGCTCGGCGGCTACCTGATGCTCTGGGCCGGCTGGCGCGCGTTGTTCGTGGTCCTGGCGCTGTTCGCC
GGGCTCTGCCTGCTGGCGGTCTGGCGGGTCGCCGAAAGCCACCCGCCGGAGCGCCGCGGCGGCAGCCTGGCCCAGGCCTTTCTCGCCTAT
GGGCGGCTGCTCGGCGACCGTCGCGCGCTGGGCTACGTGCTGTGCATGGGGCTGGCGTTCGCCGGGATGTTCGCCTACATCAGCGCCGCG
CCCTTCGTGTTCATCGAGCATTTCGGCGTGCGCGCGGAGCGCTTCGGCTGGTTCTTCGGCCTGAACATCCTCGGCGTGATGCTCGCCACC
TGGTGCAGCGCGCGCCTGGTGCGCCGCCACGGTCCGCGGCCGCTGCTGCGGGCCGGCAGCCTGCTGGCCTGCGTGTCCGGGCTGTTCCTC
CTCGGCTATGCGGCGCTCGGCGAGCGGGGCGGGTTGTGGGCGCTGGTGCCCGGCCTGCTGTGCTTCGTCAGCGTCACCGGCCTGCTCGGC
GCCAACTGCATCGCCAGCCTGCTGGCGTTGTATCCCGGACAGGCCGGGGCGGCTTCGGCGGTGGCGGTGTCCGGGCAGTTCGGCCTCGGC
TGCCTGGCCAGCCTGGCGGTCGGCTGGCTGGCGCTGCCCGGCGTGCTGCCGATGGCGCTGGTGATGGCCGTCTGCGGCGTCGGCAGCCTG
CTCGCGCTGGGCTTGGCCCTGCACGGCGGAAACCGTTGA