cdeA

Accession ARO:3003835
DefinitionClostridioides difficile and Escherichia coli multidrug efflux transporter with antiporter function. Confers resistance to fluoroquinolones in E. coli and acriflavin in Clostridioides difficile.
AMR Gene Familymultidrug and toxic compound extrusion (MATE) transporter
Drug Classacridine dye, fluoroquinolone antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Classification7 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_drug_class fluoroquinolone antibiotic [Drug Class]
+ confers_resistance_to_antibiotic acriflavine [Antibiotic]
+ multidrug and toxic compound extrusion (MATE) transporter [AMR Gene Family]
Publications

Dridi L, et al. 2004. Microb. Drug Resist. 10(3):191-6 CdeA of Clostridium difficile, a new multidrug efflux transporter of the MATE family. (PMID 15383161)

Resistomes

Prevalence of cdeA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
No prevalence data


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 810


>gb|CAE00499.1|-|cdeA [Clostridioides difficile]
MENLFTRKFTTFEFLKFVSPAIISMIFISLYTIIDGIFVSTLVGSDALASINIVLPIINLVCGFGIMMATGGGAIVSIRMGENRQDEANS
TFSFIVLFSLIVGILFTVISYFFIKEISILLGATDKLLPYCITYGKVMILCTPFYILKFIFEYFARTDGNSKFSLFLSVIGGVTNIILDY
VFIKYFGMGLLGAAVATAIGIILTCVLGIIYFLSNKSTLKLRKPKTDFRLIRDTMINGSSEMVTELSTGITTFLFNVVALKLAGENGLAA
LTIVLYAHFLMTSVYLGFAAGVSPLISYNFGAENSDKLKETFKHSLKFIFISSLLVFIIALVFAPFIVRVFVNPDNTVFKLALQGLKIFA
FAFLFVGINIFASGFFTAFHNGKISAIISFSRAFVFIIIGIIILPPMLNMTGLWLTVPFAEVITIFISILFIKKYKGRYKY


>gb|AJ574887.1|-|371-1696|cdeA [Clostridioides difficile]
ATGGAAAATTTATTTACAAGAAAATTCACTACTTTTGAATTTCTAAAATTTGTTTCTCCTGCAATTATATCCATGATATTTATATCTTTG
TACACAATAATAGATGGCATCTTTGTATCGACATTAGTTGGTTCTGATGCTCTTGCTAGTATAAATATTGTACTACCTATAATTAACCTT
GTTTGTGGATTTGGAATAATGATGGCAACTGGTGGAGGTGCTATCGTTTCTATACGTATGGGTGAAAATAGACAGGATGAAGCCAACTCT
ACATTTTCTTTTATAGTTTTGTTTTCATTGATTGTTGGGATTTTATTCACAGTAATCTCATATTTCTTTATCAAAGAAATATCTATTTTG
CTTGGTGCAACAGATAAGTTATTACCATATTGTATAACTTATGGTAAAGTTATGATTTTATGTACACCATTTTATATTTTAAAATTTATA
TTTGAGTACTTTGCAAGAACTGATGGAAATTCTAAATTTAGTTTATTTCTATCAGTCATTGGTGGTGTAACAAATATAATATTGGATTAT
GTATTTATTAAATATTTTGGAATGGGTCTTTTAGGAGCTGCAGTTGCAACTGCTATAGGTATTATTTTAACTTGTGTTTTAGGTATTATT
TACTTCTTATCTAATAAATCTACACTAAAATTAAGAAAACCAAAAACCGATTTTAGACTTATAAGAGATACTATGATAAACGGTTCTTCT
GAAATGGTTACAGAATTATCTACAGGAATTACAACATTCTTATTTAATGTAGTAGCTTTAAAATTAGCAGGAGAAAATGGACTTGCTGCT
CTTACTATAGTATTGTATGCTCATTTTTTAATGACATCAGTCTATCTAGGATTCGCTGCTGGAGTGTCTCCATTAATAAGCTATAATTTT
GGTGCTGAAAACAGTGATAAATTAAAAGAAACATTTAAACATTCTCTAAAATTTATATTTATTTCTTCTCTTTTAGTGTTTATTATTGCT
TTAGTATTTGCACCATTTATTGTTAGGGTCTTTGTAAATCCAGATAACACAGTATTTAAACTAGCCTTACAAGGATTAAAAATATTTGCA
TTTGCTTTTTTGTTTGTTGGTATAAATATATTTGCATCAGGATTTTTTACAGCATTTCACAATGGAAAAATTTCAGCTATTATATCTTTT
AGTCGTGCCTTTGTTTTTATAATCATAGGAATCATAATTCTTCCTCCTATGTTAAACATGACTGGATTATGGCTTACAGTTCCATTTGCT
GAGGTTATAACCATATTTATATCTATTCTATTTATAAAAAAATATAAAGGTAGATATAAGTATTAA