msbA

Download Sequences

Ontology	CARD's Antibiotic Resistance Ontology
Accession	ARO:3003950
CARD Short Name	msbA
Definition	MsbA is a multidrug resistance transporter homolog from E. coli and belongs to a superfamily of transporters that contain an adenosine triphosphate (ATP) binding cassette (ABC) which is also called a nucleotide-binding domain (NBD). MsbA is a member of the MDR-ABC transporter group by sequence homology. MsbA transports lipid A, a major component of the bacterial outer cell membrane, and is the only bacterial ABC transporter that is essential for cell viability.
AMR Gene Family	ATP-binding cassette (ABC) antibiotic efflux pump
Drug Class	nitroimidazole antibiotic
Resistance Mechanism	antibiotic efflux
Efflux Component	efflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect Matches	Escherichia coli^g+wgs, Shigella boydii^g+wgs, Shigella dysenteriae^g+wgs, Shigella flexneri^g+wgs, Shigella sonnei^g+wgs
Resistomes with Sequence Variants	Citrobacter amalonaticus^g+wgs, Citrobacter freundii^g+wgs, Citrobacter koseri^g+wgs, Citrobacter portucalensis^g+wgs, Citrobacter werkmanii^g+wgs, Citrobacter youngae^g+wgs, Cronobacter condimenti^g+wgs, Cronobacter dublinensis^g+wgs, Cronobacter malonaticus^g+wgs, Cronobacter sakazakii^g+wgs, Cronobacter turicensis^wgs, Cronobacter universalis^g+wgs, Enterobacter asburiae^g+wgs, Enterobacter cancerogenus^g+wgs, Enterobacter chengduensis^g+wgs, Enterobacter cloacae^g+wgs, Enterobacter hormaechei^g+wgs, Enterobacter kobei^g+wgs, Enterobacter roggenkampii^g+wgs, Escherichia albertii^g+wgs, Escherichia coli^g+wgs, Escherichia fergusonii^g+wgs, Escherichia marmotae^g+wgs, Klebsiella aerogenes^g+wgs, Klebsiella huaxiensis^g+wgs, Klebsiella michiganensis^g+wgs, Klebsiella oxytoca^g+wgs, Klebsiella pneumoniae^g+wgs, Klebsiella quasipneumoniae^g+wgs, Kosakonia arachidis^g+wgs, Leclercia adecarboxylata^g+wgs, Raoultella planticola^g+wgs, Salmonella bongori^g+wgs, Salmonella enterica^g+wgs, Shigella boydii^g+wgs, Shigella dysenteriae^g+wgs, Shigella flexneri^g+wgs, Shigella sonnei^g+wgs
Classification	7 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic molecule + antibiotic efflux [Resistance Mechanism] + nitroimidazole antibiotic [Drug Class] + efflux pump complex or subunit conferring antibiotic resistance [Efflux Component]
Parent Term(s)	2 ontology terms \| Show + ATP-binding cassette (ABC) antibiotic efflux pump [AMR Gene Family] + confers_resistance_to_antibiotic metronidazole [Antibiotic]
Publications	Boyanova L, et al. 2002. J. Med. Microbiol. 51(9):786-90 Prevalence of resistant Helicobacter pylori isolates in Bulgarian children. (PMID 12358070) Li XZ and Nikaido H. 2009. Drugs 69(12): 1555-1623. Efflux-mediated drug resistance in bacteria: an update. (PMID 19678712) Zgurskaya HI, et al. 2002. Int. J. Med. Microbiol. 292(2):95-105 Molecular analysis of efflux pump-based antibiotic resistance. (PMID 12195740) Singh H, et al. 2016. Nat Commun 7:12387 ATP-dependent substrate transport by the ABC transporter MsbA is proton-coupled. (PMID 27499013)

Resistomes

Prevalence of msbA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Citrobacter amalonaticus	0%	0%	0%	0%	0%
Citrobacter amalonaticus	100%	0%	98.18%	0%	0%
Citrobacter freundii	100%	0%	99.42%	0%	0%
Citrobacter freundii	0%	0%	0%	0%	0%
Citrobacter koseri	0%	0%	0%	0%	0%
Citrobacter koseri	100%	0%	99.1%	0%	0%
Citrobacter portucalensis	0%	0%	0%	0%	0%
Citrobacter portucalensis	100%	0%	100%	0%	0%
Citrobacter werkmanii	0%	0%	0%	0%	0%
Citrobacter werkmanii	100%	0%	100%	0%	0%
Citrobacter youngae	100%	0%	100%	0%	0%
Citrobacter youngae	0%	0%	0%	0%	0%
Cronobacter condimenti	0%	0%	0%	0%	0%
Cronobacter condimenti	100%	0%	100%	0%	0%
Cronobacter dublinensis	0%	0%	0%	0%	0%
Cronobacter dublinensis	100%	0%	100%	0%	0%
Cronobacter malonaticus	100%	0%	96.36%	0%	0%
Cronobacter malonaticus	0%	0%	0%	0%	0%
Cronobacter sakazakii	0%	0%	0%	0%	0%
Cronobacter sakazakii	100%	0%	99.33%	0%	0%
Cronobacter turicensis	0%	0%	0%	0%	0%
Cronobacter turicensis	0%	0%	100%	0%	0%
Cronobacter universalis	100%	0%	100%	0%	0%
Cronobacter universalis	0%	0%	0%	0%	0%
Enterobacter asburiae	0%	0%	0%	0%	0%
Enterobacter asburiae	100%	0%	99.6%	0%	0%
Enterobacter cancerogenus	0%	0%	0%	0%	0%
Enterobacter cancerogenus	100%	0%	100%	0%	0%
Enterobacter chengduensis	100%	0%	100%	0%	0%
Enterobacter chengduensis	0%	0%	0%	0%	0%
Enterobacter cloacae	0%	0%	0%	0%	0%
Enterobacter cloacae	100%	0%	99.36%	0%	0%
Enterobacter hormaechei	99.64%	0%	99.7%	0%	0%
Enterobacter hormaechei	0%	0%	0%	0%	0%
Enterobacter kobei	100%	0%	100%	0%	0%
Enterobacter kobei	0%	0%	0%	0%	0%
Enterobacter roggenkampii	97.67%	0%	100%	0%	0%
Enterobacter roggenkampii	0%	0%	0%	0%	0%
Escherichia albertii	100%	0%	99.35%	0%	0%
Escherichia albertii	0%	0%	0%	0%	0%
Escherichia coli	67.84%	0%	99.33%	0%	99.78%
Escherichia coli	51.5%	0%	69.76%	0%	80.94%
Escherichia fergusonii	0%	0%	0%	0%	0%
Escherichia fergusonii	98.36%	0%	100%	0%	0%
Escherichia marmotae	0%	0%	0%	0%	0%
Escherichia marmotae	100%	0%	97.92%	0%	0%
Klebsiella aerogenes	100%	0%	99.15%	0%	0%
Klebsiella aerogenes	0%	0%	0%	0%	0%
Klebsiella huaxiensis	100%	0%	100%	0%	0%
Klebsiella huaxiensis	0%	0%	0%	0%	0%
Klebsiella michiganensis	100%	0%	99.47%	0%	0%
Klebsiella michiganensis	0%	0%	0%	0%	0%
Klebsiella oxytoca	0%	0%	0%	0%	0%
Klebsiella oxytoca	100%	0%	99.58%	0%	0%
Klebsiella pneumoniae	0%	0%	0%	0%	0%
Klebsiella pneumoniae	99.7%	0%	99.43%	0%	0%
Klebsiella quasipneumoniae	0%	0%	0%	0%	0%
Klebsiella quasipneumoniae	100%	0%	99.74%	0%	0%
Kosakonia arachidis	0%	0%	0%	0%	0%
Kosakonia arachidis	100%	0%	100%	0%	0%
Leclercia adecarboxylata	0%	0%	0%	0%	0%
Leclercia adecarboxylata	100%	0%	100%	0%	0%
Raoultella planticola	100%	0%	100%	0%	0%
Raoultella planticola	0%	0%	0%	0%	0%
Salmonella bongori	100%	0%	100%	0%	0%
Salmonella bongori	0%	0%	0%	0%	0%
Salmonella enterica	0%	0%	0%	0%	0%
Salmonella enterica	95.58%	0%	99.42%	0%	0%
Shigella boydii	86.67%	0%	82.22%	0%	0%
Shigella boydii	93.33%	0%	97.78%	0%	0%
Shigella dysenteriae	85.71%	0%	70%	0%	0%
Shigella dysenteriae	100%	0%	93.33%	0%	0%
Shigella flexneri	35%	0%	4.04%	0%	0%
Shigella flexneri	100%	0%	97.98%	0%	0%
Shigella sonnei	2.44%	0%	4.6%	0%	0%
Shigella sonnei	100%	0%	99.71%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 1000

Protein
DNA

>gb|AAC74000.1|+|msbA [Escherichia coli str. K-12 substr. MG1655]
MHNDKDLSTWQTFRRLWPTIAPFKAGLIVAGVALILNAASDTFMLSLLKPLLDDGFGKTDRSVLVWMPLVVIGLMILRGITSYVSSYCIS
WVSGKVVMTMRRRLFGHMMGMPVSFFDKQSTGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILIVLAPIVSI
AIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNRMRLQGMKMVSASSISDPIIQLIASLALAFVLYAA
SFPSVMDSLTAGTITVVFSSMIALMRPLKSLTNVNAQFQRGMAACQTLFTILDSEQEKDEGKRVIERATGDVEFRNVTFTYPGRDVPALR
NINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGEILMDGHDLREYTLASLRNQVALVSQNVHLFNDTVANNIAYARTEQYSREQI
EEAARMAYAMDFINKMDNGLDTVIGENGVLLSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS
TIEKADEIVVVEDGVIVERGTHNDLLEHRGVYAQLHKMQFGQ

>gb|U00096.3|+|966621-968369|msbA [Escherichia coli str. K-12 substr. MG1655]
ATGCATAACGACAAAGATCTCTCTACGTGGCAGACATTCCGCCGACTGTGGCCAACCATTGCGCCTTTCAAAGCGGGTCTGATCGTGGCG
GGCGTAGCGTTAATCCTCAACGCAGCCAGCGATACCTTCATGTTATCGCTCCTTAAGCCACTTCTTGATGATGGCTTTGGTAAAACAGAT
CGCTCCGTGCTGGTGTGGATGCCGCTGGTGGTGATCGGGCTGATGATTTTACGTGGTATCACCAGCTATGTCTCCAGCTACTGTATCTCC
TGGGTATCAGGAAAGGTGGTAATGACCATGCGTCGCCGCCTGTTTGGTCACATGATGGGAATGCCAGTTTCATTCTTTGACAAACAGTCA
ACGGGTACGCTGTTGTCACGTATTACCTACGATTCCGAACAGGTTGCTTCTTCTTCTTCCGGCGCACTGATTACTGTTGTGCGTGAAGGT
GCGTCGATCATCGGCCTGTTCATCATGATGTTCTATTACAGTTGGCAACTGTCGATCATTTTGATTGTGCTGGCACCGATTGTTTCGATT
GCGATTCGCGTTGTATCGAAGCGTTTTCGCAACATCAGTAAAAACATGCAGAACACCATGGGGCAGGTGACCACCAGCGCAGAACAAATG
CTGAAGGGCCACAAAGAAGTATTGATTTTCGGTGGTCAGGAAGTGGAAACGAAACGCTTTGATAAAGTCAGCAACCGAATGCGTCTTCAG
GGGATGAAAATGGTTTCAGCCTCTTCCATCTCTGATCCGATCATTCAGCTGATCGCCTCTTTGGCGCTGGCGTTTGTTCTGTATGCGGCG
AGCTTCCCAAGTGTCATGGATAGCCTGACTGCCGGTACGATTACCGTTGTTTTCTCTTCAATGATTGCACTGATGCGTCCGCTGAAATCG
CTGACCAACGTTAACGCCCAGTTCCAGCGCGGTATGGCGGCTTGTCAGACGCTGTTTACCATTCTGGACAGTGAGCAGGAGAAAGATGAA
GGTAAGCGCGTGATCGAGCGTGCGACTGGCGACGTGGAATTCCGCAATGTCACCTTTACTTATCCGGGACGTGACGTACCTGCATTGCGT
AACATCAACCTGAAAATTCCGGCAGGGAAGACGGTTGCTCTGGTTGGACGCTCTGGTTCGGGTAAATCAACCATCGCCAGCCTGATCACG
CGTTTTTACGATATTGATGAAGGCGAAATCCTGATGGATGGTCACGATCTGCGCGAGTATACCCTGGCGTCGTTACGTAACCAGGTTGCT
CTGGTGTCGCAGAATGTCCATCTGTTTAACGATACGGTTGCTAACAACATTGCTTACGCACGGACTGAACAGTACAGCCGTGAGCAAATT
GAAGAAGCGGCGCGTATGGCCTACGCCATGGACTTCATCAATAAGATGGATAACGGTCTCGATACAGTGATTGGTGAAAACGGCGTGCTG
CTCTCTGGCGGTCAGCGTCAGCGTATTGCTATCGCTCGAGCCTTGTTGCGTGATAGCCCGATTCTGATTCTGGACGAAGCTACCTCGGCT
CTGGATACCGAATCCGAACGTGCGATTCAGGCGGCACTGGATGAGTTGCAGAAAAACCGTACCTCTCTGGTGATTGCCCACCGCTTGTCT
ACCATTGAAAAGGCAGACGAAATCGTGGTCGTCGAGGATGGTGTCATTGTGGAACGCGGTACGCATAACGATTTGCTTGAGCACCGCGGC
GTTTACGCGCAACTTCACAAAATGCAGTTTGGCCAATGA

Curator Acknowledgements

Curator	Description	Most Recent Edit

msbA

Prevalence: protein homolog model (view sequences)

Graph