Escherichia coli fabI mutations conferring resistance to isoniazid and triclosan

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3004045
CARD Short NameEcol_fabI_MULT
DefinitionfabI is a enoyl-acyl carrier reductase used in lipid metabolism and fatty acid biosynthesis. The bacterial biocide Triclosan blocks the final reduction step in fatty acid elongation, inhibiting biosynthesis. Point mutations in fabI can confer resistance to Triclosan and Isoniazid.
AMR Gene Familyantibiotic resistant fabI
Drug Classdisinfecting agents and antiseptics, isoniazid-like antibiotic
Resistance Mechanismantibiotic target alteration
Resistomes with Sequence VariantsEnterobacter asburiaewgs, Enterobacter cloacaewgs, Enterobacter hormaecheiwgs, Enterobacter kobeiwgs, Escherichia coliwgs, Klebsiella michiganensiswgs, Klebsiella pneumoniaeg+wgs, Klebsiella quasipneumoniaewgs, Pectobacterium parmentierig+wgs, Providencia stuartiig+wgs
Classification14 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic triclosan [Antibiotic]
+ antibiotic resistant fabI [AMR Gene Family]
Publications

Khan R, et al. 2016. Sci Rep 6:32322 Triclosan Resistome from Metagenome Reveals Diverse Enoyl Acyl Carrier Protein Reductases and Selective Enrichment of Triclosan Resistance Genes. (PMID 27577999)

Resistomes

Prevalence of Escherichia coli fabI mutations conferring resistance to isoniazid and triclosan among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Enterobacter asburiae0%0%0.79%0%0%
Enterobacter cloacae0%0%0.32%0%0%
Enterobacter hormaechei0%0%0.13%0%0%
Enterobacter kobei0%0%0.44%0%0%
Escherichia coli0%0%0.03%0%0%
Klebsiella michiganensis0%0%4.26%0%0%
Klebsiella pneumoniae0.3%0%0.42%0%0%
Klebsiella quasipneumoniae0%0%0.13%0%0%
Pectobacterium parmentieri100%0%94.12%0%0%
Providencia stuartii6.25%0%2.27%0%0%
Show Perfect Only


Detection Models

Model Type: protein variant model

Model Definition: Protein Variant Models (PVM) perform a similar search as Protein Homolog Models (PHM), i.e. detect protein sequences based on their similarity to a curated reference sequence, but secondarily screen query sequences for curated sets of mutations to differentiate them from antibiotic susceptible wild-type alleles. PVMs are designed to detect AMR acquired via mutation of house-keeping genes or antibiotic targets, e.g. a mutated gyrase resistant to aminocoumarin antibiotics. PVMs include a protein reference sequence (often from antibiotic susceptible wild-type alleles), a curated bit-score cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of single point mutations, insertions, or deletions curated from the scientific literature. A Strict RGI match has a BLASTP bit-score above the curated BLASTP cutoff value and contains at least one curated mutation from amongst the mapped resistance variants, while a Loose RGI match has a bit-score less than the curated BLASTP bit-score cut-off but still contains at least one curated mutation from amongst the mapped resistance variants.

Bit-score Cut-off (blastP): 450

PubMed: mutation data hand curated from the scientific literature, evaluated as conferring resistance (R). CRyPTIC: mutation data acquired from the CRyPTIC catalog, evaluated as resistant (R), susceptible (S), or undetermined (U). ReSeqTB: mutation data acquired from the ReSeqTB catalog, evaluated as conferring resistance (Minimal, Moderate, High), not conferring resistance (None), or Indeterminate. WHO: mutation data acquired from the WHO 2023 catalog, evaluated as resistant (R), susceptible (S), or undetermined (U).

MutationMutation typePubMed
G93Vsingle resistance variantPMID:27577999
G93Asingle resistance variantPMID:27577999
G93Ssingle resistance variantPMID:27577999
M159Tsingle resistance variantPMID:27577999
F203Csingle resistance variantPMID:27577999
F203Lsingle resistance variantPMID:27577999
F203Vsingle resistance variantPMID:27577999
F203Asingle resistance variantPMID:27577999

>gb|AAC74370.1|-|Escherichia coli fabI mutations conferring resistance to isoniazid and triclosan [Escherichia coli str. K-12 substr. MG1655]
MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIV
LQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDIS
SYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGI
SGEVVHVDGGFSIAAMNELELK



>gb|U00096.3|-|1350251-1351039|Escherichia coli fabI mutations conferring resistance to isoniazid and triclosan [Escherichia coli str. K-12 substr. MG1655]
ATGGGTTTTCTTTCCGGTAAGCGCATTCTGGTAACCGGTGTTGCCAGCAAACTATCCATCGCCTACGGTATCGCTCAGGCGATGCACCGC
GAAGGAGCTGAACTGGCATTCACCTACCAGAACGACAAACTGAAAGGCCGCGTAGAAGAATTTGCCGCTCAATTGGGTTCTGACATCGTT
CTGCAGTGCGATGTTGCAGAAGATGCCAGCATCGACACCATGTTCGCTGAACTGGGGAAAGTTTGGCCGAAATTTGACGGTTTCGTACAC
TCTATTGGTTTTGCACCTGGCGATCAGCTGGATGGTGACTATGTTAACGCCGTTACCCGTGAAGGCTTCAAAATTGCCCACGACATCAGC
TCCTACAGCTTCGTTGCAATGGCAAAAGCTTGCCGCTCCATGCTGAATCCGGGTTCTGCCCTGCTGACCCTTTCCTACCTTGGCGCTGAG
CGCGCTATCCCGAACTACAACGTTATGGGTCTGGCAAAAGCGTCTCTGGAAGCGAACGTGCGCTATATGGCGAACGCGATGGGTCCGGAA
GGTGTGCGTGTTAACGCCATCTCTGCTGGTCCGATCCGTACTCTGGCGGCCTCCGGTATCAAAGACTTCCGCAAAATGCTGGCTCATTGC
GAAGCCGTTACCCCGATTCGCCGTACCGTTACTATTGAAGATGTGGGTAACTCTGCGGCATTCCTGTGCTCCGATCTCTCTGCCGGTATC
TCCGGTGAAGTGGTCCACGTTGACGGCGGTTTCAGCATTGCTGCAATGAACGAACTCGAACTGAAATAA

Curator Acknowledgements
Curator Description Most Recent Edit