Escherichia coli fabI mutations conferring resistance to isoniazid and triclosan

Accession ARO:3004045
DefinitionfabI is a enoyl-acyl carrier reductase used in lipid metabolism and fatty acid biosynthesis. The bacterial biocide Triclosan blocks the final reduction step in fatty acid elongation, inhibiting biosynthesis. Point mutations in fabI can confer resistance to Triclosan and Isoniazid
AMR Gene Familyantibiotic resistant fabI
Drug Classisoniazid, triclosan
Resistance Mechanismantibiotic target alteration
Classification11 ontology terms | Show
Parent Term(s)1 ontology terms | Show
+ antibiotic resistant fabI [AMR Gene Family]
Publications

Khan R, et al. 2016. Sci Rep 6:32322 Triclosan Resistome from Metagenome Reveals Diverse Enoyl Acyl Carrier Protein Reductases and Selective Enrichment of Triclosan Resistance Genes. (PMID 27577999)

Resistomes

Prevalence of Escherichia coli fabI mutations conferring resistance to isoniazid and triclosan among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 85 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Enterobacter asburiae0%0%3.12%
Enterobacter cloacae0%0%0.68%
Enterobacter hormaechei0%0%0.16%
Escherichia coli0%0%0.04%
Klebsiella pneumoniae1.09%0%0.87%
Show Perfect Only


Detection Models

Model Type: protein variant model

Model Definition: The protein variant model is an AMR detection model. Protein variant models are similar to protein homolog models - they detect the presence of a protein sequence based on its similarity to a curated reference sequence, but secondarily search submitted query sequences for curated sets of mutations shown clinically to confer resistance relative to wild-type. This model includes a protein reference sequence, a curated BLASTP cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of: single resistance variants, insertions, deletions, co-dependent resistance variants, nonsense SNPs, and/or frameshift mutations. Protein variant model matches to reference sequences are categorized on two criteria: strict and loose. A strict match has a BLASTP bitscore above the curated BLASTP cutoff value and contains at least one detected mutation from amongst the mapped resistance variants; a loose match has a BLASTP bitscore below the curated BLASTP cutoff value but still contains at least one detected mutation from amongst the mapped resistance variants. Regardless of BLASTP bitscore, if a sequence does not contain one of the mapped resistance variants, it is not considered a match and not detected by the protein variant model.

Legend:

  • discovered in clinical, agricultural, or environmental isolates
  • discovered via laboratory selection experiments


Bit-score Cut-off (blastP): 450

PMID in progress (single): G93V G93S G93A M159T F203V F203A F203C F203L


>gb|AAC74370.1|-|antibiotic resistant fabI [Escherichia coli str. K-12 substr. MG1655]
MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIV
LQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDIS
SYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGI
SGEVVHVDGGFSIAAMNELELK



>gb|U00096.3|-|1350251-1351039|antibiotic resistant fabI [Escherichia coli str. K-12 substr. MG1655]
ATGGGTTTTCTTTCCGGTAAGCGCATTCTGGTAACCGGTGTTGCCAGCAAACTATCCATCGCCTACGGTATCGCTCAGGCGATGCACCGC
GAAGGAGCTGAACTGGCATTCACCTACCAGAACGACAAACTGAAAGGCCGCGTAGAAGAATTTGCCGCTCAATTGGGTTCTGACATCGTT
CTGCAGTGCGATGTTGCAGAAGATGCCAGCATCGACACCATGTTCGCTGAACTGGGGAAAGTTTGGCCGAAATTTGACGGTTTCGTACAC
TCTATTGGTTTTGCACCTGGCGATCAGCTGGATGGTGACTATGTTAACGCCGTTACCCGTGAAGGCTTCAAAATTGCCCACGACATCAGC
TCCTACAGCTTCGTTGCAATGGCAAAAGCTTGCCGCTCCATGCTGAATCCGGGTTCTGCCCTGCTGACCCTTTCCTACCTTGGCGCTGAG
CGCGCTATCCCGAACTACAACGTTATGGGTCTGGCAAAAGCGTCTCTGGAAGCGAACGTGCGCTATATGGCGAACGCGATGGGTCCGGAA
GGTGTGCGTGTTAACGCCATCTCTGCTGGTCCGATCCGTACTCTGGCGGCCTCCGGTATCAAAGACTTCCGCAAAATGCTGGCTCATTGC
GAAGCCGTTACCCCGATTCGCCGTACCGTTACTATTGAAGATGTGGGTAACTCTGCGGCATTCCTGTGCTCCGATCTCTCTGCCGGTATC
TCCGGTGAAGTGGTCCACGTTGACGGCGGTTTCAGCATTGCTGCAATGAACGAACTCGAACTGAAATAA