Escherichia coli fabG mutations conferring resistance to triclosan

Accession ARO:3004049
DefinitionfabG is a 3-oxoacyl-acyl carrier protein reductase involved in lipid metabolism and fatty acid biosynthesis.The bacterial biocide Triclosan blocks the final reduction step in fatty acid elongation, inhibiting biosynthesis. Point mutations in fabG can confer resistance to Triclosan.
AMR Gene Familyantibiotic resistance fabG
Drug Classtriclosan
Resistance Mechanismantibiotic target alteration
Classification9 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic triclosan [Drug Class]
+ determinant of triclosan resistance
+ antibiotic resistance fabG [AMR Gene Family]
Publications

Khan R, et al. 2016. Sci Rep 6:32322 Triclosan Resistome from Metagenome Reveals Diverse Enoyl Acyl Carrier Protein Reductases and Selective Enrichment of Triclosan Resistance Genes. (PMID 27577999)

Resistomes

Prevalence of Escherichia coli fabG mutations conferring resistance to triclosan among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
No prevalence data

Prevalence: protein variant model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
No prevalence data


Detection Models

Model Type: protein variant model

Model Definition: The protein variant model is an AMR detection model. Protein variant models are similar to protein homolog models - they detect the presence of a protein sequence based on its similarity to a curated reference sequence, but secondarily search submitted query sequences for curated sets of mutations shown clinically to confer resistance relative to wild-type. This model includes a protein reference sequence, a curated BLASTP cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of: single resistance variants, insertions, deletions, co-dependent resistance variants, nonsense SNPs, and/or frameshift mutations. Protein variant model matches to reference sequences are categorized on two criteria: strict and loose. A strict match has a BLASTP bitscore above the curated BLASTP cutoff value and contains at least one detected mutation from amongst the mapped resistance variants; a loose match has a BLASTP bitscore below the curated BLASTP cutoff value but still contains at least one detected mutation from amongst the mapped resistance variants. Regardless of BLASTP bitscore, if a sequence does not contain one of the mapped resistance variants, it is not considered a match and not detected by the protein variant model.

Legend:

  • discovered in clinical, agricultural, or environmental isolates
  • discovered via laboratory selection experiments


Bit-score Cut-off (blastP): 400


>gb|NP_415611.1|+|antibiotic resistant fabG [Escherichia coli str. K-12 substr. MG1655]
MNFEGKIALVTGASRGIGRAIAETLAARGAKVIGTATSENGAQAISDYLGANGKGLMLNV
TDPASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKA
VMRAMMKKRHGRIITIGSVVGTMGNGGQANYAAAKAGLIGFSKSLAREVASRGITVNVVA
PGFIETDMTRALSDDQRAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGG
MYMV



>gb|NC_000913.3|+|1150670-1151404|antibiotic resistant fabG [Escherichia coli str. K-12 substr. MG1655]
ATGAATTTTGAAGGAAAAATCGCACTGGTAACCGGTGCAAGCCGCGGAATTGGCCGCGCAATTGCTGAAACGCTCGCAGCCCGTGGCGCG
AAAGTTATTGGCACTGCGACCAGTGAAAATGGCGCTCAGGCGATCAGTGATTATTTAGGTGCCAACGGCAAAGGTCTGATGTTGAATGTG
ACCGACCCGGCATCTATCGAATCTGTTCTGGAAAAAATTCGCGCAGAATTTGGTGAAGTGGATATCCTGGTCAATAATGCCGGTATCACT
CGTGATAACCTGTTAATGCGAATGAAAGATGAAGAGTGGAACGATATTATCGAAACCAACCTTTCATCTGTTTTCCGTCTGTCAAAAGCG
GTAATGCGCGCTATGATGAAAAAGCGTCATGGTCGTATTATCACTATCGGTTCTGTGGTTGGTACCATGGGAAATGGCGGTCAGGCCAAC
TACGCTGCGGCGAAAGCGGGCTTGATCGGCTTCAGTAAATCACTGGCGCGCGAAGTTGCGTCACGCGGTATTACTGTAAACGTTGTTGCT
CCGGGCTTTATTGAAACGGACATGACACGTGCGCTGAGCGATGACCAGCGTGCGGGTATCCTGGCGCAGGTTCCTGCGGGTCGCCTCGGC
GGCGCACAGGAAATCGCCAACGCGGTTGCATTCCTGGCATCCGACGAAGCAGCTTACATCACGGGTGAAACTTTGCATGTGAACGGCGGG
ATGTACATGGTCTGA


Model Type: protein variant model

Model Definition: The protein variant model is an AMR detection model. Protein variant models are similar to protein homolog models - they detect the presence of a protein sequence based on its similarity to a curated reference sequence, but secondarily search submitted query sequences for curated sets of mutations shown clinically to confer resistance relative to wild-type. This model includes a protein reference sequence, a curated BLASTP cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of: single resistance variants, insertions, deletions, co-dependent resistance variants, nonsense SNPs, and/or frameshift mutations. Protein variant model matches to reference sequences are categorized on two criteria: strict and loose. A strict match has a BLASTP bitscore above the curated BLASTP cutoff value and contains at least one detected mutation from amongst the mapped resistance variants; a loose match has a BLASTP bitscore below the curated BLASTP cutoff value but still contains at least one detected mutation from amongst the mapped resistance variants. Regardless of BLASTP bitscore, if a sequence does not contain one of the mapped resistance variants, it is not considered a match and not detected by the protein variant model.

Legend:

  • discovered in clinical, agricultural, or environmental isolates
  • discovered via laboratory selection experiments


Bit-score Cut-off (blastP): 400


>gb|AAC74177.1|+|antibiotic resistant fabG [Escherichia coli str. K-12 substr. MG1655]
MNFEGKIALVTGASRGIGRAIAETLAARGAKVIGTATSENGAQAISDYLGANGKGLMLNV
TDPASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKA
VMRAMMKKRHGRIITIGSVVGTMGNGGQANYAAAKAGLIGFSKSLAREVASRGITVNVVA
PGFIETDMTRALSDDQRAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGG
MYMV



>gb|U00096.3|+|1150670-1151404|antibiotic resistant fabG [Escherichia coli str. K-12 substr. MG1655]
ATGAATTTTGAAGGAAAAATCGCACTGGTAACCGGTGCAAGCCGCGGAATTGGCCGCGCAATTGCTGAAACGCTCGCAGCCCGTGGCGCG
AAAGTTATTGGCACTGCGACCAGTGAAAATGGCGCTCAGGCGATCAGTGATTATTTAGGTGCCAACGGCAAAGGTCTGATGTTGAATGTG
ACCGACCCGGCATCTATCGAATCTGTTCTGGAAAAAATTCGCGCAGAATTTGGTGAAGTGGATATCCTGGTCAATAATGCCGGTATCACT
CGTGATAACCTGTTAATGCGAATGAAAGATGAAGAGTGGAACGATATTATCGAAACCAACCTTTCATCTGTTTTCCGTCTGTCAAAAGCG
GTAATGCGCGCTATGATGAAAAAGCGTCATGGTCGTATTATCACTATCGGTTCTGTGGTTGGTACCATGGGAAATGGCGGTCAGGCCAAC
TACGCTGCGGCGAAAGCGGGCTTGATCGGCTTCAGTAAATCACTGGCGCGCGAAGTTGCGTCACGCGGTATTACTGTAAACGTTGTTGCT
CCGGGCTTTATTGAAACGGACATGACACGTGCGCTGAGCGATGACCAGCGTGCGGGTATCCTGGCGCAGGTTCCTGCGGGTCGCCTCGGC
GGCGCACAGGAAATCGCCAACGCGGTTGCATTCCTGGCATCCGACGAAGCAGCTTACATCACGGGTGAAACTTTGCATGTGAACGGCGGG
ATGTACATGGTCTGA