Campylobacter coli chloramphenicol acetyltransferase

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3004454
CARD Short NameCcol_ACT_CHL
DefinitionA chloramphenicol resistance determinant described in Campylobacter coli.
AMR Gene Familychloramphenicol acetyltransferase (CAT)
Drug Classphenicol antibiotic
Resistance Mechanismantibiotic inactivation
Classification8 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ chloramphenicol acetyltransferase (CAT) [AMR Gene Family]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
Resistomes with Perfect MatchesCampylobacter colig+wgs, Campylobacter jejunig+wgs, Helicobacter pullorumwgs, Helicobacter pyloriwgs
Resistomes with Sequence VariantsCampylobacter colig+wgs, Campylobacter jejunig+wgs, Helicobacter pullorumwgs, Helicobacter pyloriwgs, Klebsiella pneumoniaewgs
Publications

Wang Y and Taylor DE. 1990. Gene 94(1): 23-28. Chloramphenicol resistance in Campylobacter coli: nucleotide sequence, expression, and cloning vector construction. (PMID 2227449)

Resistomes

Prevalence of Campylobacter coli chloramphenicol acetyltransferase among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Campylobacter coli15.94%0%7.92%0%0%
Campylobacter jejuni1.4%0%0.41%0%0%
Helicobacter pullorum0%0%3.45%0%0%
Helicobacter pylori0%0%0.86%0%0%
Klebsiella pneumoniae0%0%0.02%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 350


>gb|AAA23018.1|+|Campylobacter coli chloramphenicol acetyltransferase [Campylobacter coli]
MQFTKIDINNWTRKEYFDHYFGNTPCTYSMTVKLDISKLKKDGKKLYPTLLYGVTTIINRHEEFRTALDENGQVGVFSEMLPCYTVFHKE
TETFSSIWTEFTADYTEFLQNYQKDIDAFGERMGMSAKPNPPENTFPVSMIPWTSFEGFNLNLKKGYDYLLPIFTFGKYYEEGGKYYIPL
SIQVHHAVCDGFHVCRFLDELQDLLNK


>gb|M35190.1|+|309-932|Campylobacter coli chloramphenicol acetyltransferase [Campylobacter coli]
ATGCAATTCACAAAGATTGATATAAATAATTGGACACGAAAAGAGTATTTCGACCACTATTTTGGCAATACGCCCTGCACATATAGTATG
ACGGTAAAACTCGATATTTCTAAGTTGAAAAAGGATGGAAAAAAGTTATACCCAACTCTTTTATATGGAGTTACAACGATCATCAATCGA
CATGAAGAGTTCAGGACCGCATTAGATGAAAACGGACAGGTAGGCGTTTTTTCAGAAATGCTGCCTTGCTACACAGTTTTTCATAAGGAA
ACTGAAACCTTTTCGAGTATTTGGACTGAGTTTACAGCAGACTATACTGAGTTTCTTCAGAACTATCAAAAGGATATAGACGCTTTTGGT
GAACGAATGGGAATGTCCGCAAAGCCTAATCCTCCGGAAAACACTTTCCCTGTTTCTATGATACCGTGGACAAGCTTTGAAGGCTTTAAC
TTAAATCTAAAAAAAGGATATGACTATCTACTGCCGATATTTACGTTTGGGAAGTATTATGAGGAGGGCGGAAAATACTATATTCCCTTA
TCGATTCAAGTGCATCATGCCGTTTGTGACGGCTTTCATGTTTGCCGTTTTTTGGATGAATTACAAGACTTGCTGAATAAATAA

Curator Acknowledgements
Curator Description Most Recent Edit