Streptococcus suis chloramphenicol acetyltransferase

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3004455
CARD Short NameSsui_ACT_CHL
DefinitionA chloramphenicol resistance determinant described in Streptococcus suis.
AMR Gene Familychloramphenicol acetyltransferase (CAT)
Drug Classphenicol antibiotic
Resistance Mechanismantibiotic inactivation
Classification8 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ chloramphenicol acetyltransferase (CAT) [AMR Gene Family]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
Resistomes with Perfect MatchesStreptococcus pyogenesg+wgs, Streptococcus suiswgs
Resistomes with Sequence VariantsAliarcobacter butzlerig+p, Bacillus subtilisg+p+wgs, Campylobacter colig+wgs, Campylobacter jejunig+p+wgs, Enterococcus faecaliswgs, Enterococcus faeciump+wgs, Jeotgalibaca porcig, Serratia marcescenswgs, Staphylococcus aureusg+p+wgs, Staphylococcus epidermidisg+p, Staphylococcus hominisp, Staphylococcus pseudintermediuswgs, Streptococcus agalactiaeg+wgs, Streptococcus anginosuswgs, Streptococcus gallolyticuswgs, Streptococcus gordoniiwgs, Streptococcus lutetiensiswgs, Streptococcus mitisg+wgs, Streptococcus pneumoniaeg+wgs, Streptococcus pyogenesg+wgs, Streptococcus suisg+wgs
Publications

Takamatsu D, et al. 2003. Plasmid 49(2): 143-151. Chloramphenicol resistance transposable element TnSs1 of Streptococcus suis, a transposon flanked by IS6-family elements. (PMID 12726767)

Resistomes

Prevalence of Streptococcus suis chloramphenicol acetyltransferase among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Aliarcobacter butzleri12.5%33.33%0%0%0%
Bacillus subtilis4.3%0.63%0.58%0%0%
Campylobacter coli10.14%0%0.88%0%0%
Campylobacter jejuni2.11%0.99%0.27%0%0%
Enterococcus faecalis0%0%0.12%0%0%
Enterococcus faecium0%0.26%1.49%0%0%
Jeotgalibaca porci100%0%0%0%0%
Serratia marcescens0%0%0.26%0%0%
Staphylococcus aureus0.09%0.22%0.16%0%0%
Staphylococcus epidermidis0.65%0.58%0%0%0%
Staphylococcus hominis0%2.08%0%0%0%
Staphylococcus pseudintermedius0%0%0.26%0%0%
Streptococcus agalactiae1.87%0%0.58%0%0%
Streptococcus anginosus0%0%1.17%0%0%
Streptococcus gallolyticus0%0%2.27%0%0%
Streptococcus gordonii0%0%1.28%0%0%
Streptococcus lutetiensis0%0%2.04%0%0%
Streptococcus mitis11.11%0%0.51%0%0%
Streptococcus pneumoniae8.74%0%5.28%0%0%
Streptococcus pyogenes0.37%0%0.15%0%0%
Streptococcus suis1.6%0%2.1%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 350


>gb|BAC11901.1|+|Streptococcus suis chloramphenicol acetyltransferase [Streptococcus suis]
MNFNKIDLDNWKRKEIFNHYLNQQTTFSITTEIDISVLYRNIKQKRYKFYPAFVFLVTRVINSNTAFRTGYNSEGELGYWDKLDPLYTIF
DSVSKTFSGIWTPARNDFKEFYDLYLSDVEKYNGSGKLFPKTPIPENAFSISIIPWTSFTGFNLNINNNSNYLLPIITAGKFINKGNSIY
LPLSLQVHHSVCDGYHAGLFMNSIQELADRPNDWLF


>gb|AB080798.1|+|2659-3309|Streptococcus suis chloramphenicol acetyltransferase [Streptococcus suis]
ATGAACTTTAATAAAATTGATTTAGACAATTGGAAGAGAAAAGAGATATTTAATCATTATTTGAACCAACAAACGACTTTTAGTATAACC
ACAGAAATTGATATTAGTGTTTTATACCGAAACATAAAACAAAAAAGATATAAATTTTATCCTGCATTTGTTTTCTTAGTGACAAGGGTG
ATAAACTCAAATACAGCTTTTAGAACTGGTTACAATAGCGAGGGAGAGTTAGGCTATTGGGATAAGTTAGACCCACTATACACAATTTTT
GATAGTGTATCTAAAACATTCTCTGGTATTTGGACTCCTGCAAGGAATGACTTCAAAGAGTTTTATGATTTATACCTTTCTGATGTAGAG
AAATATAATGGTTCGGGGAAATTGTTTCCCAAAACACCTATACCCGAAAATGCTTTTTCTATTTCTATTATTCCATGGACTTCATTTACT
GGGTTTAACTTAAATATCAATAATAATAGTAATTATCTTCTACCCATTATTACAGCAGGAAAATTCATTAATAAAGGTAATTCAATATAT
TTACCGCTATCTTTACAGGTACATCATTCTGTTTGTGATGGTTATCATGCAGGATTGTTTATGAACTCTATTCAGGAATTGGCAGATAGG
CCTAATGACTGGCTTTTTTAA

Curator Acknowledgements
Curator Description Most Recent Edit