Staphylococcus intermedius chloramphenicol acetyltransferase

Accession ARO:3004457
CARD Short NameSint_ACT_CHL
DefinitionA chloramphenicol resistance determinant described in Staphylococcus intermedius.
AMR Gene Familychloramphenicol acetyltransferase (CAT)
Drug Classphenicol antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Sequence VariantsBrevibacillus laterosporuswgs, Enterococcus faecaliswgs, Klebsiella pneumoniaewgs, Staphylococcus aureusp+wgs, Staphylococcus capitiswgs, Staphylococcus epidermidisp+wgs, Staphylococcus equorumwgs, Staphylococcus haemolyticuswgs, Staphylococcus hominiswgs, Staphylococcus lugdunensiswgs, Staphylococcus pseudintermediuswgs
Classification8 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ chloramphenicol acetyltransferase (CAT) [AMR Gene Family]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
Publications

Schwarz S, et al. 1991. J Gen Microbiol 137(4): 977-981. Cloning and sequence analysis of a plasmid-encoded chloramphenicol acetyltransferase gene from Staphylococcus intermedius. (PMID 1713259)

Resistomes

Prevalence of Staphylococcus intermedius chloramphenicol acetyltransferase among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Brevibacillus laterosporus0%0%2.94%0%0%
Enterococcus faecalis0%0%0.04%0%0%
Klebsiella pneumoniae0%0%0.03%0%0%
Staphylococcus aureus0%0.37%0.67%0%0%
Staphylococcus capitis0%0%0.63%0%0%
Staphylococcus epidermidis0%0.29%1.51%0%0%
Staphylococcus equorum0%0%1.79%0%0%
Staphylococcus haemolyticus0%0%9.45%0%0%
Staphylococcus hominis0%0%0.49%0%0%
Staphylococcus lugdunensis0%0%1.54%0%0%
Staphylococcus pseudintermedius0%0%0.26%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 350


>gb|AAA26615.1|+|Staphylococcus intermedius chloramphenicol acetyltransferase [Staphylococcus intermedius]
MTFNIIKLENWDRKEYFEHYFNQQTTYSITKEIDITLFKDMIKKKGYEIYPSLIYAIMEVVNKNKVFRTGINSENKLGYWDKLNPLYTVF
NKQTEKFTNIWTESDNNFTSFYNNYKNDLFEYKDKEEMFPKKPIPENTIPISMIPWIDFSSFNLNIGNNSSFLLPIITIGKFYSENNKIY
IPVALQLHHAVCDGYHASLFINEFQDIIKKVDDWI


>gb|M64281.1|+|208-855|Staphylococcus intermedius chloramphenicol acetyltransferase [Staphylococcus intermedius]
ATGACTTTTAATATTATCAAATTAGAAAATTGGGATAGAAAAGAATATTTTGAACACTATTTTAACCAGCAAACTACGTATAGCATTACT
AAAGAAATTGATATTACTTTGTTTAAAGATATGATAAAAAAGAAAGGATATGAAATTTATCCTTCTTTGATTTATGCAATTATGGAAGTT
GTAAATAAAAATAAAGTGTTTAGAACAGGAATTAATAGTGAGAATAAATTAGGCTATTGGGATAAGTTAAATCCTTTGTATACAGTTTTT
AATAAGCAAACTGAAAAATTTACTAACATTTGGACTGAATCTGATAACAACTTCACTTCTTTTTATAATAATTATAAAAATGACTTGTTT
GAATATAAAGATAAAGAAGAAATGTTTCCTAAAAAACCGATACCTGAAAACACCATACCGATTTCAATGATTCCTTGGATTGATTTTAGT
TCATTTAATTTAAACATTGGTAACAATAGCAGCTTTTTATTGCCTATTATTACGATAGGTAAATTTTATAGTGAGAATAATAAAATTTAT
ATACCAGTTGCCTTACAGCTTCATCATGCTGTATGTGATGGTTACCATGCTTCATTATTTATAAATGAATTTCAAGATATAATTAAGAAG
GTAGATGATTGGATTTAG

Curator Acknowledgements
Curator Description Most Recent Edit