Enterococcus faecalis chloramphenicol acetyltransferase

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3004458
CARD Short NameEfae_ACT_CHL
DefinitionA chloramphenicol acetyltransferase and resistance determinant described in Enterococcus faecalis.
AMR Gene Familychloramphenicol acetyltransferase (CAT)
Drug Classphenicol antibiotic
Resistance Mechanismantibiotic inactivation
Classification8 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ chloramphenicol acetyltransferase (CAT) [AMR Gene Family]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
Resistomes with Perfect MatchesEnterococcus faecalisg+p+wgs, Enterococcus faeciump+wgs, Staphylococcus aureuswgs, Staphylococcus epidermidiswgs, Staphylococcus haemolyticuswgs, Staphylococcus hominisp+wgs, Staphylococcus pseudintermediusg+wgs, Streptococcus agalactiaewgs, Streptococcus suiswgs
Resistomes with Sequence VariantsEnterococcus faecalisg+p+wgs, Enterococcus faeciump+wgs, Mycobacterium tuberculosiswgs, Staphylococcus aureusp+wgs, Staphylococcus epidermidisp+wgs, Staphylococcus haemolyticuswgs, Staphylococcus hominisp+wgs, Staphylococcus pseudintermediusg+wgs, Staphylococcus saprophyticuswgs, Staphylococcus warneriwgs, Streptococcus agalactiaewgs, Streptococcus suiswgs
Publications

Schwarz FV, et al. 2001. Plasmid 46(3): 170-187. Sequence of the 50-kb conjugative multiresistance plasmid pRE25 from Enterococcus faecalis RE25. (PMID 11735367)

Resistomes

Prevalence of Enterococcus faecalis chloramphenicol acetyltransferase among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Enterococcus faecalis0.45%0.99%3.04%0%0%
Enterococcus faecium0%0.71%1.9%0%0%
Mycobacterium tuberculosis0%0%0.02%0%0%
Staphylococcus aureus0%0.22%0.74%0%0%
Staphylococcus epidermidis0%0.29%0.42%0%0%
Staphylococcus haemolyticus0%0%2.86%0%0%
Staphylococcus hominis0%4.17%1.95%0%0%
Staphylococcus pseudintermedius10%0%26.67%0%0%
Staphylococcus saprophyticus0%0%0.7%0%0%
Staphylococcus warneri0%0%2.46%0%0%
Streptococcus agalactiae0%0%0.06%0%0%
Streptococcus suis0%0%1%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 350


>gb|CAA63498.2|-|Enterococcus faecalis chloramphenicol acetyltransferase [Enterococcus faecalis]
MTFNIIELENWDRKEYFEHYFNQQTTYSITKEIDITLFKDMIKKKGYEIYPSLIYAIMEVVNKNKVFRTGINSENKLGYWDKLNPLYTVF
NKQTEKFTNIWTESDKNFISFYNNYKNDLLEYKDKEEMFPKKPIPENTIPISMIPWIDFSSFNLNIGNNSSFLLPIITIGKFYSENNKIY
IPVALQLHHSVCDGYHASLFMNEFQDIIHRVDDWI


>gb|X92945.2|-|8935-9582|Enterococcus faecalis chloramphenicol acetyltransferase [Enterococcus faecalis]
ATGACTTTTAATATTATTGAATTAGAAAATTGGGATAGAAAAGAATATTTTGAACACTATTTTAATCAGCAAACTACTTATAGCATTACT
AAAGAAATTGATATTACTTTGTTTAAAGATATGATAAAAAAGAAAGGATATGAAATTTATCCCTCTTTAATTTATGCAATTATGGAAGTT
GTAAATAAAAATAAAGTGTTTAGAACAGGAATTAATAGTGAGAATAAATTAGGTTATTGGGATAAGTTAAATCCTTTGTATACAGTTTTT
AATAAGCAAACTGAAAAATTTACTAACATTTGGACTGAATCTGATAAAAACTTCATTTCTTTTTATAATAATTATAAAAATGACTTGCTT
GAATATAAAGATAAAGAAGAAATGTTTCCTAAAAAACCGATACCTGAAAACACCATACCGATTTCAATGATTCCTTGGATTGATTTTAGT
TCATTTAATTTAAATATTGGTAACAATAGCAGCTTTTTATTGCCTATTATTACGATAGGTAAATTTTATAGTGAGAATAATAAAATTTAT
ATACCAGTTGCTCTGCAACTTCATCATTCTGTATGTGATGGTTACCATGCTTCACTATTTATGAATGAATTTCAAGATATAATTCATAGG
GTAGATGATTGGATTTAG

Curator Acknowledgements
Curator Description Most Recent Edit