Acinetobacter baumannii AbaQ

Accession ARO:3004574
Synonym(s)P0DPR4
DefinitionAbaQ is an MFS transporter mainly involved in the extrusion of quinolone-type drugs in A. baumannii
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classtetracycline antibiotic, bicyclomycin, fosfomycin, rifamycin antibiotic, isoniazid, diaminopyrimidine antibiotic, nucleoside antibiotic, acridine dye, fluoroquinolone antibiotic, nitroimidazole antibiotic, peptide antibiotic, antibacterial free fatty acids, rhodamine, phenicol antibiotic, penam, cephalosporin, macrolide antibiotic, benzalkonium chloride, lincosamide antibiotic, oxazolidinone antibiotic, glycylcycline
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesAcinetobacter baumanniig+wgs, Acinetobacter nosocomialisg+wgs
Classification30 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_drug_class fluoroquinolone antibiotic [Drug Class]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
Publications

PĂ©rez-Varela M, et al. 2018. Antimicrob. Agents Chemother. 62(9): Functional Characterization of AbaQ, a Novel Efflux Pump Mediating Quinolone Resistance in Acinetobacter baumannii. (PMID 29941648)

Resistomes

Prevalence of Acinetobacter baumannii AbaQ among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii94.9%0%95.19%
Acinetobacter nosocomialis87.5%0%98%
Pseudomonas fluorescens88.89%0%83.74%
Pseudomonas putida21.21%0%27.5%
Pseudomonas stutzeri11.76%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 600


>gb|ACJ41547.2|-|Acinetobacter baumannii AbaQ [Acinetobacter baumannii AB0057]
MDFEKDVIRTVTFKLIPALVILYLVAYIDRAAVGFAHLHMGADVGIGDAAYGLGAGLFFIGYFLFEVPSNLLLDKFGARKWFTRILLTWG
LITMAMALIQGPKSFYLLRFLLGVAEAGFFPGVLYLITQWYPVRHRGKIMGMFVLSQPIAMMIAGPLAGLLLGMDGIANLHGWQWLFVAV
GLPAVLLALPTFLWLPDNIDKVKWLSIEQKQWLKNELVKDEAEYDQTRHANPLHALKDKRVLLLALYYLPVTLSIYGLNLWLPTIIKQFG
GGSDIQIGFLSSIPYIFGIIGLLIIPRSTDRLNDRYGHLSFLYALGACAMFLSGWLNSPVMQLAALAVVAFCLFSSTAVFWTLPGRFLTG
ASAAAGIALINSVGNLGGYVGPFGIGLLKEYTGNMAAGLYFLSIVMLFGLILTYIVYAKLERQKTQTVNIQKPL


>gb|CP001182.2|-|2255585-2256889|Acinetobacter baumannii AbaQ [Acinetobacter baumannii AB0057]
ATGGATTTCGAAAAGGATGTAATACGGACAGTCACGTTTAAGCTGATACCTGCATTAGTCATACTATATCTGGTGGCATACATTGATCGG
GCCGCTGTCGGGTTTGCCCATCTGCATATGGGTGCCGATGTAGGAATTGGTGATGCTGCCTATGGCCTAGGAGCTGGCTTATTTTTTATT
GGATATTTTCTTTTTGAAGTTCCAAGTAATTTGCTTTTAGACAAATTTGGTGCTCGTAAATGGTTTACCCGCATTTTATTAACATGGGGC
CTCATCACCATGGCCATGGCGCTTATTCAAGGCCCTAAAAGTTTTTATCTCTTAAGGTTTTTACTCGGTGTAGCAGAGGCGGGTTTTTTC
CCTGGTGTTTTATACCTAATTACGCAGTGGTATCCGGTGCGGCATCGCGGAAAAATTATGGGAATGTTTGTGCTTTCACAACCGATTGCC
ATGATGATTGCAGGGCCTTTAGCTGGTCTATTACTTGGAATGGATGGCATTGCAAATTTGCACGGCTGGCAATGGTTGTTTGTTGCAGTT
GGCTTGCCCGCAGTTTTATTAGCTTTACCTACATTTCTGTGGCTGCCAGATAACATTGATAAAGTAAAATGGTTAAGCATTGAACAAAAA
CAATGGCTTAAAAATGAACTCGTTAAAGATGAAGCCGAATATGACCAAACCCGACATGCCAATCCACTACATGCTTTAAAAGACAAACGC
GTACTTTTATTAGCACTTTACTACTTACCGGTAACTTTAAGTATTTATGGTTTAAATCTCTGGCTTCCTACCATTATTAAGCAATTTGGC
GGAGGTAGTGATATTCAAATTGGGTTCTTATCTAGCATTCCCTATATTTTTGGAATTATTGGACTTCTCATTATTCCGCGTAGTACTGAC
CGCCTGAACGATCGTTACGGACACTTAAGTTTTCTGTATGCACTAGGTGCTTGTGCAATGTTTTTAAGTGGTTGGCTAAATTCTCCAGTT
ATGCAGTTGGCAGCTTTGGCTGTAGTTGCGTTCTGTCTATTTTCATCGACTGCCGTGTTTTGGACATTACCGGGTCGTTTCTTAACGGGT
GCAAGTGCAGCGGCTGGTATCGCCTTAATTAACTCTGTTGGAAATTTAGGTGGCTATGTCGGTCCATTTGGCATCGGACTTTTAAAAGAA
TACACGGGAAATATGGCTGCTGGTTTGTATTTCTTATCTATCGTCATGCTTTTTGGCTTGATTCTGACTTACATCGTCTATGCCAAGCTC
GAACGTCAAAAAACACAAACAGTGAATATTCAAAAGCCTTTGTAA