Acinetobacter baumannii AbaQ

Accession ARO:3004574
Synonym(s)P0DPR4
CARD Short NameAbau_AbaQ
DefinitionAbaQ is an MFS transporter mainly involved in the extrusion of quinolone-type drugs in A. baumannii.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classfluoroquinolone antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect MatchesAcinetobacter baumanniig+wgs, Acinetobacter nosocomialisg+wgs, Acinetobacter pittiiwgs
Resistomes with Sequence VariantsAcinetobacter baumanniig+wgs, Acinetobacter calcoaceticusg+wgs, Acinetobacter indicusg, Acinetobacter lwoffiig, Acinetobacter nosocomialisg+wgs, Acinetobacter pittiig+wgs, Acinetobacter radioresistenswgs, Klebsiella pneumoniaewgs, Pseudomonas aeruginosawgs, Pseudomonas brassicacearumg+wgs, Pseudomonas chlororaphisg+wgs, Pseudomonas fluorescensg+wgs, Pseudomonas koreensisg+wgs, Pseudomonas mendocinag, Pseudomonas monteiliig+wgs, Pseudomonas putidag+wgs, Pseudomonas synxanthag+wgs, Pseudomonas syringaeg+wgs, Stenotrophomonas maltophiliawgs
Classification6 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
+ confers_resistance_to_drug_class fluoroquinolone antibiotic [Drug Class]
Publications

PĂ©rez-Varela M, et al. 2018. Antimicrob. Agents Chemother. 62(9): Functional Characterization of AbaQ, a Novel Efflux Pump Mediating Quinolone Resistance in Acinetobacter baumannii. (PMID 29941648)

Resistomes

Prevalence of Acinetobacter baumannii AbaQ among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Acinetobacter baumannii96.8%0%68.07%0%
Acinetobacter calcoaceticus100%0%21.74%0%
Acinetobacter indicus4.76%0%0%0%
Acinetobacter lwoffii10%0%0%0%
Acinetobacter nosocomialis90.91%0%74.68%0%
Acinetobacter pittii90.62%0%77.3%0%
Acinetobacter radioresistens0%0%2.44%0%
Klebsiella pneumoniae0%0%0.01%0%
Pseudomonas aeruginosa0%0%0.05%0%
Pseudomonas brassicacearum100%0%79.17%0%
Pseudomonas chlororaphis62.07%0%41.86%0%
Pseudomonas fluorescens85.71%0%49.12%0%
Pseudomonas koreensis100%0%94.74%0%
Pseudomonas mendocina14.29%0%0%0%
Pseudomonas monteilii100%0%45%0%
Pseudomonas putida22%0%28.08%0%
Pseudomonas synxantha100%0%87.5%0%
Pseudomonas syringae97.62%0%77.43%0%
Stenotrophomonas maltophilia0%0%0.17%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 600


>gb|ACJ41547.2|-|Acinetobacter baumannii AbaQ [Acinetobacter baumannii AB0057]
MDFEKDVIRTVTFKLIPALVILYLVAYIDRAAVGFAHLHMGADVGIGDAAYGLGAGLFFIGYFLFEVPSNLLLDKFGARKWFTRILLTWG
LITMAMALIQGPKSFYLLRFLLGVAEAGFFPGVLYLITQWYPVRHRGKIMGMFVLSQPIAMMIAGPLAGLLLGMDGIANLHGWQWLFVAV
GLPAVLLALPTFLWLPDNIDKVKWLSIEQKQWLKNELVKDEAEYDQTRHANPLHALKDKRVLLLALYYLPVTLSIYGLNLWLPTIIKQFG
GGSDIQIGFLSSIPYIFGIIGLLIIPRSTDRLNDRYGHLSFLYALGACAMFLSGWLNSPVMQLAALAVVAFCLFSSTAVFWTLPGRFLTG
ASAAAGIALINSVGNLGGYVGPFGIGLLKEYTGNMAAGLYFLSIVMLFGLILTYIVYAKLERQKTQTVNIQKPL


>gb|CP001182.2|-|2255585-2256889|Acinetobacter baumannii AbaQ [Acinetobacter baumannii AB0057]
ATGGATTTCGAAAAGGATGTAATACGGACAGTCACGTTTAAGCTGATACCTGCATTAGTCATACTATATCTGGTGGCATACATTGATCGG
GCCGCTGTCGGGTTTGCCCATCTGCATATGGGTGCCGATGTAGGAATTGGTGATGCTGCCTATGGCCTAGGAGCTGGCTTATTTTTTATT
GGATATTTTCTTTTTGAAGTTCCAAGTAATTTGCTTTTAGACAAATTTGGTGCTCGTAAATGGTTTACCCGCATTTTATTAACATGGGGC
CTCATCACCATGGCCATGGCGCTTATTCAAGGCCCTAAAAGTTTTTATCTCTTAAGGTTTTTACTCGGTGTAGCAGAGGCGGGTTTTTTC
CCTGGTGTTTTATACCTAATTACGCAGTGGTATCCGGTGCGGCATCGCGGAAAAATTATGGGAATGTTTGTGCTTTCACAACCGATTGCC
ATGATGATTGCAGGGCCTTTAGCTGGTCTATTACTTGGAATGGATGGCATTGCAAATTTGCACGGCTGGCAATGGTTGTTTGTTGCAGTT
GGCTTGCCCGCAGTTTTATTAGCTTTACCTACATTTCTGTGGCTGCCAGATAACATTGATAAAGTAAAATGGTTAAGCATTGAACAAAAA
CAATGGCTTAAAAATGAACTCGTTAAAGATGAAGCCGAATATGACCAAACCCGACATGCCAATCCACTACATGCTTTAAAAGACAAACGC
GTACTTTTATTAGCACTTTACTACTTACCGGTAACTTTAAGTATTTATGGTTTAAATCTCTGGCTTCCTACCATTATTAAGCAATTTGGC
GGAGGTAGTGATATTCAAATTGGGTTCTTATCTAGCATTCCCTATATTTTTGGAATTATTGGACTTCTCATTATTCCGCGTAGTACTGAC
CGCCTGAACGATCGTTACGGACACTTAAGTTTTCTGTATGCACTAGGTGCTTGTGCAATGTTTTTAAGTGGTTGGCTAAATTCTCCAGTT
ATGCAGTTGGCAGCTTTGGCTGTAGTTGCGTTCTGTCTATTTTCATCGACTGCCGTGTTTTGGACATTACCGGGTCGTTTCTTAACGGGT
GCAAGTGCAGCGGCTGGTATCGCCTTAATTAACTCTGTTGGAAATTTAGGTGGCTATGTCGGTCCATTTGGCATCGGACTTTTAAAAGAA
TACACGGGAAATATGGCTGCTGGTTTGTATTTCTTATCTATCGTCATGCTTTTTGGCTTGATTCTGACTTACATCGTCTATGCCAAGCTC
GAACGTCAAAAAACACAAACAGTGAATATTCAAAAGCCTTTGTAA