catII from Escherichia coli K-12

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3004656
CARD Short NameEcol_catII
DefinitioncatII is a chloramphenicol acetyltransferase. This particular catII is found in E.coli K-12. Confers resistance to chloramphenicol.
AMR Gene Familychloramphenicol acetyltransferase (CAT)
Drug Classphenicol antibiotic
Resistance Mechanismantibiotic inactivation
Classification8 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ chloramphenicol acetyltransferase (CAT) [AMR Gene Family]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
Resistomes with Perfect MatchesMorganella morganiig+wgs, Vibrio choleraewgs
Resistomes with Sequence VariantsAeromonas hydrophilag, Citrobacter freundiip+wgs, Citrobacter koseriwgs, Citrobacter portucalensisp+wgs, Citrobacter werkmaniiwgs, Cronobacter malonaticuswgs, Cronobacter sakazakiip, Enterobacter asburiaep+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaeg+p+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiip+wgs, Escherichia colig+p+wgs, Escherichia fergusoniiwgs, Klebsiella aerogenesp+wgs, Klebsiella huaxiensisg, Klebsiella michiganensisp+wgs, Klebsiella oxytocawgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatawgs, Morganella morganiig+wgs, Proteus mirabiliswgs, Providencia rettgeriwgs, Pseudomonas aeruginosawgs, Raoultella planticolap+wgs, Salmonella entericag+p+wgs, Serratia marcescensp+wgs, Shigella boydiiwgs, Shigella flexnerip, Shigella sonneiwgs, Staphylococcus aureuswgs, Vibrio alginolyticusg, Vibrio choleraep+wgs, Vibrio vulnificuswgs
Publications

Murray IA, et al. 1990. Biochem J 272(2): 505-510. Nucleotide sequences of genes encoding the type II chloramphenicol acetyltransferases of Escherichia coli and Haemophilus influenzae, which are sensitive to inhibition by thiol-reactive reagents. (PMID 2268278)

Resistomes

Prevalence of catII from Escherichia coli K-12 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Aeromonas hydrophila1.54%0%0%0%0%
Citrobacter freundii0%3.69%11.8%0%0%
Citrobacter koseri0%0%0.9%0%0%
Citrobacter portucalensis0%2.94%12.61%0%0%
Citrobacter werkmanii0%0%53.85%0%0%
Cronobacter malonaticus0%0%1.82%0%0%
Cronobacter sakazakii0%2.56%0%0%0%
Enterobacter asburiae0%0.28%1.98%0%0%
Enterobacter chengduensis0%0%8%0%0%
Enterobacter cloacae1.79%1.12%7.99%0%0%
Enterobacter hormaechei0%2.45%13.51%0%0%
Enterobacter kobei0%1.38%6.55%0%0%
Enterobacter roggenkampii0%0.48%3.6%0%0%
Escherichia coli0.02%0.13%0.75%0%0%
Escherichia fergusonii0%0%1.09%0%0%
Klebsiella aerogenes0%1.09%0.56%0%0%
Klebsiella huaxiensis100%0%0%0%0%
Klebsiella michiganensis0%1.14%1.33%0%0%
Klebsiella oxytoca0%0%1.68%0%0%
Klebsiella pneumoniae0%2.42%7.83%0%0%
Klebsiella quasipneumoniae0%1.27%3.55%0%0%
Leclercia adecarboxylata0%0%41.86%0%0%
Morganella morganii42.31%0%45.4%0%0%
Proteus mirabilis0%0%0.33%0%0%
Providencia rettgeri0%0%0.64%0%0%
Pseudomonas aeruginosa0%0%0.01%0%0%
Raoultella planticola0%2.33%2.56%0%0%
Salmonella enterica0.38%1.2%0.51%0%0%
Serratia marcescens0%0.65%0.13%0%0%
Shigella boydii0%0%2.22%0%0%
Shigella flexneri0%1.61%0%0%0%
Shigella sonnei0%0%0.51%0%0%
Staphylococcus aureus0%0%0.01%0%0%
Vibrio alginolyticus1.23%0%0%0%0%
Vibrio cholerae0%5.26%0.45%0%0%
Vibrio vulnificus0%0%0.41%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 420


>gb|CAA37805.1|+|catII from Escherichia coli K-12 [Escherichia coli str. K-12]
MNFTRIDLNTWNRREHFALYRQQIKCGFSLTTKLDITALRTALAETGYKFYPLMIYLISRAVNQFPEFRMALKDNELIYWDQSDPVFTVF
HKETETFSALSCRYFPDLSEFMAGYNAVTAEYQHDTRLFPQGNLPENHLNISSLPWVSFDGFNLNITGNDDYFAPVFTMAKFQQEGDRVL
LPVSVQVHHAVCDGFHAARFINTLQLMCDNILK


>gb|X53796.1|+|187-828|catII from Escherichia coli K-12 [Escherichia coli str. K-12]
ATGAATTTTACCCGGATTGACCTGAATACCTGGAATCGCAGGGAACACTTTGCCCTTTATCGTCAGCAGATTAAATGCGGATTCAGCCTG
ACCACCAAACTCGATATTACCGCTTTGCGTACCGCACTGGCGGAGACAGGTTATAAGTTTTATCCGCTGATGATTTACCTGATCTCCCGG
GCTGTTAATCAGTTTCCGGAGTTCCGGATGGCACTGAAAGACAATGAACTTATTTACTGGGACCAGTCAGACCCGGTCTTTACTGTCTTT
CATAAAGAAACCGAAACATTCTCTGCACTGTCCTGCCGTTATTTTCCGGATCTCAGTGAGTTTATGGCAGGTTATAATGCGGTAACGGCA
GAATATCAGCATGATACCAGATTGTTTCCGCAGGGAAATTTACCGGAGAATCACCTGAATATATCATCATTACCGTGGGTGAGTTTTGAC
GGATTTAACCTGAACATCACCGGAAATGATGATTATTTTGCCCCGGTTTTTACGATGGCAAAGTTTCAGCAGGAAGGTGACCGCGTATTA
TTACCTGTTTCTGTACAGGTTCATCATGCAGTATGTGATGGCTTTCATGCAGCACGGTTTATTAATACACTTCAGCTGATGTGTGATAAC
ATACTGAAATAA

Curator Acknowledgements
Curator Description Most Recent Edit