catA8

Accession ARO:3004658
DefinitioncatA8 is a chloramphenicol acetyltransferase that confers resistance to chloramphenicol.
AMR Gene Familychloramphenicol acetyltransferase (CAT)
Drug Classphenicol antibiotic
Resistance Mechanismantibiotic inactivation
ResistomesEnterococcus faecaliswgs, Enterococcus faeciump+wgs, Streptococcus agalactiaeg
Classification9 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ chloramphenicol acetyltransferase (CAT) [AMR Gene Family]
+ confers_resistance_to_drug_class chloramphenicol [Antibiotic]
Publications

Schwarz FV, et al. 2001. Plasmid 46(3): 170-187. Sequence of the 50-kb conjugative multiresistance plasmid pRE25 from Enterococcus faecalis RE25. (PMID 11735367)

Perreten V, et al. 2001. Antimicrob Agents Chemother 45(4): 1109-1114. Mdt(A), a new efflux protein conferring multiple antibiotic resistance in Lactococcus lactis and Escherichia coli. (PMID 11257023)

Perreten V, et al. 1997. Nature 389(6653): 801-802. Antibiotic resistance spread in food. (PMID 9349809)

Resistomes

Prevalence of catA8 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Enterococcus faecalis0%1.77%9.3%
Enterococcus faecium0%0.53%1.48%
Staphylococcus aureus0%0.08%0.09%
Staphylococcus epidermidis0%0%4.04%
Streptococcus agalactiae1.12%0%0%
Streptococcus pneumoniae0%0%0.01%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 400


>gb|AFN69318.1|+|catA8 [Listeria monocytogenes]
MTFNIINLETWDRKEYFNHYFNQQTTYSVTKEFDITLLKSMIKNKGYELYPALIYTIVNIINQNKVFRTGINSEGNLGYWEKLNPLYTVF
NKETEKFSNIWTESNVSFNSFYNSYKSDLLEYKDKNEMFPKKPIPENTVPISMIPWIDFSSFNLNIGNNSRFLLPIITIGKFYSKNNKIY
LPVSLQVHHAVCDGYHVSLFMSEFQNIVDSVNEWI


>gb|JQ922409.1|+|93-740|catA8 [Listeria monocytogenes]
ATGACTTTTAATATTATTAATTTGGAAACTTGGGATAGAAAAGAATATTTTAATCATTATTTCAATCAACAAACAACTTACAGTGTTACT
AAAGAATTTGATATCACTTTACTTAAAAGTATGATAAAAAATAAAGGATATGAACTGTATCCTGCTTTGATTTATACAATTGTAAATATT
ATAAATCAAAATAAAGTATTTAGAACAGGAATTAATAGTGAGGGAAATTTGGGTTATTGGGAAAAATTAAACCCTTTATATACAGTCTTT
AATAAAGAAACTGAAAAATTTTCTAACATTTGGACAGAATCAAATGTTAGTTTTAATTCTTTTTATAATAGTTATAAGAGTGACTTACTT
GAATATAAAGATAAAAATGAAATGTTTCCTAAAAAACCAATACCTGAAAACACAGTTCCTATTTCGATGATTCCTTGGATTGATTTTAGT
TCATTTAATTTAAATATTGGTAATAATAGTAGATTCCTATTGCCAATTATTACAATAGGTAAATTTTATAGTAAGAATAATAAGATCTAT
TTACCAGTCTCATTGCAAGTTCATCATGCGGTATGTGATGGTTACCATGTTTCATTATTTATGAGTGAATTTCAAAATATAGTTGATAGT
GTAAATGAATGGATTTAA