catA8

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3004658
CARD Short NamecatA8
DefinitioncatA8 is a chloramphenicol acetyltransferase that confers resistance to chloramphenicol.
AMR Gene Familychloramphenicol acetyltransferase (CAT)
Drug Classphenicol antibiotic
Resistance Mechanismantibiotic inactivation
Classification8 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ chloramphenicol acetyltransferase (CAT) [AMR Gene Family]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
Resistomes with Perfect MatchesEnterococcus faecaliswgs, Enterococcus faeciump+wgs, Enterococcus hiraep+wgs, Lactococcus garvieaep, Listeria innocuap, Streptococcus agalactiaeg+wgs
Resistomes with Sequence VariantsEnterococcus faecalisg+p+wgs, Enterococcus faeciump+wgs, Enterococcus hiraep+wgs, Glaesserella parasuiswgs, Lactobacillus crispatusg, Lactococcus garvieaep, Listeria innocuap, Staphylococcus arlettaewgs, Staphylococcus aureusp+wgs, Staphylococcus epidermidiswgs, Staphylococcus equorumwgs, Staphylococcus haemolyticusp+wgs, Staphylococcus pasteuriwgs, Streptococcus agalactiaeg+wgs, Streptococcus dysgalactiaeg, Streptococcus iniaep, Streptococcus pneumoniaewgs, Streptococcus suisg+wgs
Publications

Schwarz FV, et al. 2001. Plasmid 46(3): 170-187. Sequence of the 50-kb conjugative multiresistance plasmid pRE25 from Enterococcus faecalis RE25. (PMID 11735367)

Perreten V, et al. 2001. Antimicrob Agents Chemother 45(4): 1109-1114. Mdt(A), a new efflux protein conferring multiple antibiotic resistance in Lactococcus lactis and Escherichia coli. (PMID 11257023)

Perreten V, et al. 1997. Nature 389(6653): 801-802. Antibiotic resistance spread in food. (PMID 9349809)

Resistomes

Prevalence of catA8 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Enterococcus faecalis5.45%8.62%11%0%0%
Enterococcus faecium0%0.52%2.44%0%0%
Enterococcus hirae0%2.38%0.46%0%0%
Escherichia coli0%0%0%0%0%
Glaesserella parasuis0%0%3.08%0%0%
Lactobacillus crispatus4%0%0%0%0%
Lactococcus garvieae0%8.33%0%0%0%
Listeria innocua0%10.53%0%0%0%
Staphylococcus arlettae0%0%7.5%0%0%
Staphylococcus aureus0%0.15%0.08%0%0%
Staphylococcus epidermidis0%0%1.76%0%0%
Staphylococcus equorum0%0%3.57%0%0%
Staphylococcus haemolyticus0%3.77%1.32%0%0%
Staphylococcus pasteuri0%0%3.85%0%0%
Streptococcus agalactiae0.93%0%0.71%0%0%
Streptococcus dysgalactiae2%0%0%0%0%
Streptococcus iniae0%100%0%0%0%
Streptococcus pneumoniae0%0%0.01%0%0%
Streptococcus suis0.8%0%1.36%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|AFN69318.1|+|catA8 [Listeria monocytogenes]
MTFNIINLETWDRKEYFNHYFNQQTTYSVTKEFDITLLKSMIKNKGYELYPALIYTIVNIINQNKVFRTGINSEGNLGYWEKLNPLYTVF
NKETEKFSNIWTESNVSFNSFYNSYKSDLLEYKDKNEMFPKKPIPENTVPISMIPWIDFSSFNLNIGNNSRFLLPIITIGKFYSKNNKIY
LPVSLQVHHAVCDGYHVSLFMSEFQNIVDSVNEWI


>gb|JQ922409.1|+|93-740|catA8 [Listeria monocytogenes]
ATGACTTTTAATATTATTAATTTGGAAACTTGGGATAGAAAAGAATATTTTAATCATTATTTCAATCAACAAACAACTTACAGTGTTACT
AAAGAATTTGATATCACTTTACTTAAAAGTATGATAAAAAATAAAGGATATGAACTGTATCCTGCTTTGATTTATACAATTGTAAATATT
ATAAATCAAAATAAAGTATTTAGAACAGGAATTAATAGTGAGGGAAATTTGGGTTATTGGGAAAAATTAAACCCTTTATATACAGTCTTT
AATAAAGAAACTGAAAAATTTTCTAACATTTGGACAGAATCAAATGTTAGTTTTAATTCTTTTTATAATAGTTATAAGAGTGACTTACTT
GAATATAAAGATAAAAATGAAATGTTTCCTAAAAAACCAATACCTGAAAACACAGTTCCTATTTCGATGATTCCTTGGATTGATTTTAGT
TCATTTAATTTAAATATTGGTAATAATAGTAGATTCCTATTGCCAATTATTACAATAGGTAAATTTTATAGTAAGAATAATAAGATCTAT
TTACCAGTCTCATTGCAAGTTCATCATGCGGTATGTGATGGTTACCATGTTTCATTATTTATGAGTGAATTTCAAAATATAGTTGATAGT
GTAAATGAATGGATTTAA

Curator Acknowledgements
Curator Description Most Recent Edit