catB11

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3004660
CARD Short NamecatB11
DefinitioncatB11 is a chloramphenicol acetyltransferase that confers resistance to chloramphenicol.
AMR Gene Familychloramphenicol acetyltransferase (CAT)
Drug Classphenicol antibiotic
Resistance Mechanismantibiotic inactivation
Classification8 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ chloramphenicol acetyltransferase (CAT) [AMR Gene Family]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
Resistomes with Perfect MatchesAcinetobacter baumanniiwgs, Aeromonas hydrophilap+wgs, Citrobacter freundiiwgs, Enterobacter cloacaewgs, Enterobacter hormaecheiwgs, Escherichia colip+wgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaep+wgs, Providencia rettgeriwgs, Pseudomonas aeruginosag+wgs
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Actinobacillus pleuropneumoniaeg, Aeromonas hydrophilap+wgs, Citrobacter freundiiwgs, Enterobacter cloacaewgs, Enterobacter hormaecheiwgs, Escherichia colip+wgs, Klebsiella michiganensisg+p+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs, Proteus mirabiliswgs, Providencia rettgeriwgs, Pseudomonas aeruginosag+p+wgs, Pseudomonas putidawgs, Staphylococcus aureuswgs, Stutzerimonas stutzerip
Publications

Partridge SR, et al. 2009. FEMS Microbiol Rev 33(4):757-84 Gene cassettes and cassette arrays in mobile resistance integrons. (PMID 19416365)

Resistomes

Prevalence of catB11 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0%0%0.03%0%0%
Actinobacillus pleuropneumoniae2.78%0%0%0%0%
Aeromonas hydrophila0%1.3%1.61%0%0%
Citrobacter freundii0%0%1.74%0%0%
Enterobacter cloacae0%0%0.96%0%0%
Enterobacter hormaechei0%0%0.35%0%0%
Escherichia coli0%0.01%0.02%0%0%
Klebsiella michiganensis1.61%0.57%2.13%0%0%
Klebsiella oxytoca0%0.68%0.42%0%0%
Klebsiella pneumoniae0.12%0.05%0.17%0%0%
Proteus mirabilis0%0%0.17%0%0%
Providencia rettgeri0%0%0.64%0%0%
Pseudomonas aeruginosa0.15%0.29%0.1%0%0%
Pseudomonas putida0%0%1.6%0%0%
Staphylococcus aureus0%0%0.01%0%0%
Stutzerimonas stutzeri0%9.09%0%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 350


>gb|AID93387.1|+|catB11 [Klebsiella oxytoca KONIH1]
MKNYFESPFKGKPLVEQVKNPNIKVGRYSYYSGYYHGHSFDDCARYLLPDRDDVDKLIIGSFCSIGTGASFIMAGNQGHRYDWVTSFPFF
YMNEEPAFSESVDAFQAAGNTVIGSDVWIGSEAMIMPGVKVGHGAVIGSRALVTKDIEPYTIVGGNPAKEIKKRFSEQEISMLLDMKWWD
WPLEQIKEAMPLLCSSDIAGLYHFWQRSSA


>gb|CP008790.1|+|144511-145143|catB11 [Klebsiella oxytoca KONIH1]
ATGAAGAACTATTTTGAGAGCCCGTTTAAGGGAAAACCTCTCGTCGAACAGGTAAAGAACCCAAATATCAAGGTGGGCCGTTATAGCTAT
TATTCAGGCTATTACCACGGGCATTCATTTGATGATTGCGCTCGCTACCTCCTGCCTGATCGTGATGACGTTGATAAATTGATAATTGGA
AGCTTTTGCTCCATAGGGACGGGTGCATCTTTTATCATGGCTGGAAATCAAGGTCACCGATATGATTGGGTTACATCATTCCCTTTTTTC
TATATGAATGAGGAACCGGCATTTTCGGAATCAGTTGATGCTTTCCAGGCGGCAGGTAATACCGTCATAGGAAGCGACGTGTGGATTGGC
TCTGAAGCAATGATTATGCCTGGAGTAAAGGTTGGCCATGGAGCGGTAATTGGCAGCCGGGCTTTGGTTACCAAAGATATAGAGCCATAC
ACAATTGTTGGTGGCAACCCTGCAAAAGAGATAAAGAAGCGCTTTTCAGAACAGGAAATTTCAATGTTGCTAGATATGAAGTGGTGGGAT
TGGCCGTTGGAGCAAATTAAAGAAGCAATGCCTCTTTTGTGCTCGTCTGATATTGCAGGCTTGTACCATTTTTGGCAGCGTTCAAGTGCC
TAA

Curator Acknowledgements
Curator Description Most Recent Edit