catB11

Download Sequences

Accession	ARO:3004660
CARD Short Name	catB11
Definition	catB11 is a chloramphenicol acetyltransferase that confers resistance to chloramphenicol.
AMR Gene Family	chloramphenicol acetyltransferase (CAT)
Drug Class	phenicol antibiotic
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Acinetobacter baumannii^wgs, Aeromonas hydrophila^p+wgs, Citrobacter freundii^wgs, Enterobacter cloacae^wgs, Enterobacter hormaechei^wgs, Escherichia coli^p+wgs, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^p+wgs, Klebsiella pneumoniae^p+wgs, Providencia rettgeri^wgs, Pseudomonas aeruginosa^g+wgs
Resistomes with Sequence Variants	Acinetobacter baumannii^wgs, Actinobacillus pleuropneumoniae^g, Aeromonas hydrophila^p+wgs, Citrobacter freundii^wgs, Enterobacter cloacae^wgs, Enterobacter hormaechei^wgs, Escherichia coli^p+wgs, Klebsiella michiganensis^g+p+wgs, Klebsiella oxytoca^p+wgs, Klebsiella pneumoniae^g+p+wgs, Proteus mirabilis^wgs, Providencia rettgeri^wgs, Pseudomonas aeruginosa^g+p+wgs, Pseudomonas putida^wgs, Pseudomonas stutzeri^p, Staphylococcus aureus^wgs
Classification	8 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic molecule + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + phenicol antibiotic [Drug Class] + acylation of antibiotic conferring resistance
Parent Term(s)	2 ontology terms \| Show + chloramphenicol acetyltransferase (CAT) [AMR Gene Family] + confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
Publications	Partridge SR, et al. 2009. FEMS Microbiol Rev 33(4):757-84 Gene cassettes and cassette arrays in mobile resistance integrons. (PMID 19416365)

Resistomes

Prevalence of catB11 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Acinetobacter baumannii	0%	0%	0.03%	0%	0%
Acinetobacter baumannii	0%	0%	0.03%	0%	0%
Actinobacillus pleuropneumoniae	2.78%	0%	0%	0%	0%
Actinobacillus pleuropneumoniae	0%	0%	0%	0%	0%
Aeromonas hydrophila	0%	1.3%	1.61%	0%	0%
Aeromonas hydrophila	0%	1.3%	1.61%	0%	0%
Citrobacter freundii	0%	0%	1.74%	0%	0%
Citrobacter freundii	0%	0%	1.74%	0%	0%
Enterobacter cloacae	0%	0%	0.96%	0%	0%
Enterobacter cloacae	0%	0%	0.96%	0%	0%
Enterobacter hormaechei	0%	0%	0.35%	0%	0%
Enterobacter hormaechei	0%	0%	0.35%	0%	0%
Escherichia coli	0%	0.01%	0.02%	0%	0%
Escherichia coli	0%	0.01%	0.02%	0%	0%
Klebsiella michiganensis	1.61%	0.57%	2.13%	0%	0%
Klebsiella michiganensis	0%	0.57%	1.06%	0%	0%
Klebsiella oxytoca	0%	0.68%	0.42%	0%	0%
Klebsiella oxytoca	0%	0.68%	0.42%	0%	0%
Klebsiella pneumoniae	0%	0.05%	0.16%	0%	0%
Klebsiella pneumoniae	0.12%	0.05%	0.17%	0%	0%
Proteus mirabilis	0%	0%	0.17%	0%	0%
Proteus mirabilis	0%	0%	0%	0%	0%
Providencia rettgeri	0%	0%	0.64%	0%	0%
Providencia rettgeri	0%	0%	0.64%	0%	0%
Pseudomonas aeruginosa	0.15%	0%	0.07%	0%	0%
Pseudomonas aeruginosa	0.15%	0.29%	0.1%	0%	0%
Pseudomonas putida	0%	0%	0%	0%	0%
Pseudomonas putida	0%	0%	1.6%	0%	0%
Pseudomonas stutzeri	0%	0%	0%	0%	0%
Pseudomonas stutzeri	0%	9.09%	0%	0%	0%
Staphylococcus aureus	0%	0%	0%	0%	0%
Staphylococcus aureus	0%	0%	0.01%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 350

Protein
DNA

>gb|AID93387.1|+|catB11 [Klebsiella oxytoca KONIH1]
MKNYFESPFKGKPLVEQVKNPNIKVGRYSYYSGYYHGHSFDDCARYLLPDRDDVDKLIIGSFCSIGTGASFIMAGNQGHRYDWVTSFPFF
YMNEEPAFSESVDAFQAAGNTVIGSDVWIGSEAMIMPGVKVGHGAVIGSRALVTKDIEPYTIVGGNPAKEIKKRFSEQEISMLLDMKWWD
WPLEQIKEAMPLLCSSDIAGLYHFWQRSSA

>gb|CP008790.1|+|144511-145143|catB11 [Klebsiella oxytoca KONIH1]
ATGAAGAACTATTTTGAGAGCCCGTTTAAGGGAAAACCTCTCGTCGAACAGGTAAAGAACCCAAATATCAAGGTGGGCCGTTATAGCTAT
TATTCAGGCTATTACCACGGGCATTCATTTGATGATTGCGCTCGCTACCTCCTGCCTGATCGTGATGACGTTGATAAATTGATAATTGGA
AGCTTTTGCTCCATAGGGACGGGTGCATCTTTTATCATGGCTGGAAATCAAGGTCACCGATATGATTGGGTTACATCATTCCCTTTTTTC
TATATGAATGAGGAACCGGCATTTTCGGAATCAGTTGATGCTTTCCAGGCGGCAGGTAATACCGTCATAGGAAGCGACGTGTGGATTGGC
TCTGAAGCAATGATTATGCCTGGAGTAAAGGTTGGCCATGGAGCGGTAATTGGCAGCCGGGCTTTGGTTACCAAAGATATAGAGCCATAC
ACAATTGTTGGTGGCAACCCTGCAAAAGAGATAAAGAAGCGCTTTTCAGAACAGGAAATTTCAATGTTGCTAGATATGAAGTGGTGGGAT
TGGCCGTTGGAGCAAATTAAAGAAGCAATGCCTCTTTTGTGCTCGTCTGATATTGCAGGCTTGTACCATTTTTGGCAGCGTTCAAGTGCC
TAA

Curator Acknowledgements

Curator	Description	Most Recent Edit

catB11

Prevalence: protein homolog model (view sequences)

Graph