HERA-3

Accession ARO:3004818
CARD Short NameHERA-3
DefinitionHERA-3 is a class A beta-lactamase found in Escherichia hermannii.
AMR Gene FamilyHERA beta-lactamase
Drug Classpenam
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesEscherichia coliwgs, Salmonella entericawgs
Resistomes with Sequence VariantsEscherichia coliwgs, Salmonella entericawgs
Classification12 ontology terms | Show
Parent Term(s)1 ontology terms | Show
+ HERA beta-lactamase [AMR Gene Family]
Publications

Beauchef-Havard A, et al. 2003. Antimicrob. Agents Chemother. 47(8):2669-73 Molecular and biochemical characterization of a novel class A beta-lactamase (HER-1) from Escherichia hermannii. (PMID 12878539)

Resistomes

Prevalence of HERA-3 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 263 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Escherichia coli0%0%0.02%0%
Salmonella enterica0%0%0.16%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 590


>gb|AAL26996.1|+|HERA-3 [Atlantibacter hermannii]
MKKITPLFAIAFLTLIALLAPAQASVTPDMTDFLRQQEQRLHARIGMAVVNAQGETVFGYRQDERFPLTSTFKTLACAALLERLQKNGGS
LDEQVTIPPDALLDYAPVTKNYLAPATISLRMLCAAAVSYSDNTAGNRILTYLGGPDAVTQFMRGIGDHVTRLDRTEPTLNEATPGDARD
TSSPQKMAAGLQKILTAPPLTPANRAVLAQWMRDDKVGDALLRAALPKGWAIADKTGAGGYGSRAIIAAVYPPERPPFYVAIFITQTEAS
MKMANETIAEIGKQLFAGQP


>gb|AF398335.1|+|1-873|HERA-3 [Atlantibacter hermannii]
ATGAAAAAAATCACCCCGCTCTTTGCCATCGCATTTCTGACCCTGATCGCGTTACTGGCTCCGGCACAGGCCTCCGTCACGCCAGACATG
ACGGACTTTTTACGCCAGCAAGAGCAACGGCTTCACGCCAGAATTGGCATGGCGGTTGTCAACGCACAAGGCGAAACGGTGTTCGGTTAT
CGGCAGGACGAGCGTTTCCCGCTGACCAGCACCTTTAAAACCCTGGCCTGCGCCGCGTTGCTTGAGCGATTGCAGAAAAACGGCGGTTCG
CTGGATGAACAGGTGACTATTCCGCCAGACGCGTTGCTGGACTATGCGCCAGTGACTAAAAACTACCTCGCCCCTGCCACCATCTCCTTA
CGCATGTTGTGCGCAGCGGCGGTGAGCTACAGCGACAACACGGCGGGCAACCGCATTCTGACTTACCTTGGCGGCCCGGATGCCGTCACG
CAGTTTATGCGCGGGATCGGCGACCATGTGACCCGTCTGGATCGAACGGAGCCCACGCTGAATGAAGCCACGCCAGGCGATGCGCGCGAT
ACCTCTTCGCCGCAGAAGATGGCGGCAGGGCTGCAAAAAATCCTCACCGCCCCTCCCCTGACGCCGGCTAACCGGGCGGTGCTGGCGCAG
TGGATGCGTGACGATAAAGTGGGAGATGCGCTGCTACGCGCCGCGCTGCCGAAAGGCTGGGCAATTGCCGATAAAACCGGGGCGGGCGGC
TACGGCTCGCGGGCGATTATCGCGGCGGTCTATCCGCCGGAACGCCCGCCGTTTTATGTCGCGATTTTTATTACGCAAACGGAAGCCTCG
ATGAAAATGGCAAATGAAACCATTGCTGAAATCGGCAAGCAGTTGTTTGCCGGGCAGCCCTGA