Neisseria gonorrhoeae rpld

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3004956
CARD Short NameNgon_rpld
Definitionrpld encodes for the 50S L4 ribosomal protein, is a macrolide resistance protein identified in Neisseria gonorrhoeae.
AMR Gene Family50S rRNA with mutation conferring resistance to macrolide antibiotics
Drug Classpeptide antibiotic, nonribosomal peptide antibiotics, glycopeptide antibiotic, macrolide antibiotic
Resistance Mechanismantibiotic target alteration
Classification21 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic azithromycin [Antibiotic]
+ 50S rRNA with mutation conferring resistance to macrolide antibiotics [AMR Gene Family]
Publications

Grad YH, et al. 2016. J. Infect. Dis. 214(10):1579-1587 Genomic Epidemiology of Gonococcal Resistance to Extended-Spectrum Cephalosporins, Macrolides, and Fluoroquinolones in the United States, 2000-2013. (PMID 27638945)

Demczuk W, et al. 2016. J. Clin. Microbiol. 54(5):1304-13 Genomic Epidemiology and Molecular Resistance Mechanisms of Azithromycin-Resistant Neisseria gonorrhoeae in Canada from 1997 to 2014. (PMID 26935729)

Resistomes

Prevalence of Neisseria gonorrhoeae rpld among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
No prevalence data


Detection Models

Model Type: protein variant model

Model Definition: Protein Variant Models (PVM) perform a similar search as Protein Homolog Models (PHM), i.e. detect protein sequences based on their similarity to a curated reference sequence, but secondarily screen query sequences for curated sets of mutations to differentiate them from antibiotic susceptible wild-type alleles. PVMs are designed to detect AMR acquired via mutation of house-keeping genes or antibiotic targets, e.g. a mutated gyrase resistant to aminocoumarin antibiotics. PVMs include a protein reference sequence (often from antibiotic susceptible wild-type alleles), a curated bit-score cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of single point mutations, insertions, or deletions curated from the scientific literature. A Strict RGI match has a BLASTP bit-score above the curated BLASTP cutoff value and contains at least one curated mutation from amongst the mapped resistance variants, while a Loose RGI match has a bit-score less than the curated BLASTP bit-score cut-off but still contains at least one curated mutation from amongst the mapped resistance variants.

Bit-score Cut-off (blastP): 400

PubMed: mutation data hand curated from the scientific literature, evaluated as conferring resistance (R). CRyPTIC: mutation data acquired from the CRyPTIC catalog, evaluated as resistant (R), susceptible (S), or undetermined (U). ReSeqTB: mutation data acquired from the ReSeqTB catalog, evaluated as conferring resistance (Minimal, Moderate, High), not conferring resistance (None), or Indeterminate. WHO: mutation data acquired from the WHO 2023 catalog, evaluated as resistant (R), susceptible (S), or undetermined (U).

MutationMutation typePubMed
G70Dsingle resistance variantPMID:27638945

>gb|WP_003690088.1|-|Neisseria gonorrhoeae rpld [Neisseria gonorrhoeae]
MELKVIDAKGQVSGSLSVSDALFAREYNEALVHQLVNAYLANARSGNRAQKTRAEVKHST
KKPWRQKGTGRARSGMTSSPLWRKGGRAFPNKPDENFTQKVNRKMYRAGMATILSQLARD
ERLFVIEALTAETPKTKVFAEQVKNLALEQVLFVTKRLDENVYLASRNLPNVLVLEAQQV
DPYSLLRYKKVIITKDAVAQLEEQWV



>gb|AE004969.1|-|1805309-1805929|Neisseria gonorrhoeae rpld [Neisseria gonorrhoeae]
ATGGAATTGAAAGTAATTGACGCTAAAGGACAAGTTTCAGGCAGCCTGTCTGTTTCTGATGCTTTGTTCGCCCGCGAATACAATGAAGCG
TTGGTTCACCAGCTGGTAAATGCCTACTTGGCAAACGCCCGCTCTGGTAACCGTGCTCAAAAAACCCGTGCCGAAGTAAAACACTCAACC
AAAAAACCATGGCGTCAAAAAGGTACCGGCCGCGCCCGTTCCGGTATGACTTCTTCTCCGCTGTGGCGTAAAGGCGGTCGCGCGTTCCCG
AACAAACCCGACGAAAACTTCACTCAAAAAGTAAACCGTAAAATGTACCGTGCCGGTATGGCGACTATCCTGTCCCAATTGGCGCGTGAC
GAGCGTTTGTTTGTGATTGAGGCGTTGACTGCCGAAACTCCCAAAACCAAAGTTTTTGCCGAACAAGTAAAAAATTTGGCTCTGGAGCAA
GTGCTGTTTGTAACCAAACGGCTCGACGAGAATGTTTACTTGGCTTCACGCAACTTGCCAAACGTATTGGTTTTGGAAGCTCAACAAGTT
GATCCTTACAGCTTGCTGCGTTATAAAAAAGTAATCATCACTAAAGATGCGGTTGCACAATTAGAGGAGCAATGGGTATGA

Curator Acknowledgements
Curator Description Most Recent Edit