Mycobacterium tuberculosis eis with mutation conferring resistance to kanamycin

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3004963
CARD Short NameMtub_eis_KAN
DefinitionMutations in eis that contribute to or confer resistance to kanamycin.
AMR Gene Familykanamycin-resistant eis
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic target alteration
Classification9 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ kanamycin-resistant eis [AMR Gene Family]
Publications

Zaunbrecher MA, et al. 2009. Proc Natl Acad Sci U S A 106(47):20004-9 Overexpression of the chromosomally encoded aminoglycoside acetyltransferase eis confers kanamycin resistance in Mycobacterium tuberculosis. (PMID 19906990)

Ezewudo M, et al. 2018. Sci Rep 8(1):15382 Integrating standardized whole genome sequence analysis with a global Mycobacterium tuberculosis antibiotic resistance knowledgebase. (PMID 30337678)

The CRyPTIC Consortium 2022. PLoS Biol 20(8):e3001721 A data compendium associating the genomes of 12,289 Mycobacterium tuberculosis isolates with quantitative resistance phenotypes to 13 antibiotics. (PMID 35944069)

World Health Organization. 2023. ISBN 978-92-4-008241-0. Catalogue of mutations in Mycobacterium tuberculosis complex and their association with drug resistance. Second Edition. (ISBN 978-92-4-008241-0)

Resistomes

Prevalence of Mycobacterium tuberculosis eis with mutation conferring resistance to kanamycin among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
No prevalence data


Detection Models

Model Type: protein variant model

Model Definition: Protein Variant Models (PVM) perform a similar search as Protein Homolog Models (PHM), i.e. detect protein sequences based on their similarity to a curated reference sequence, but secondarily screen query sequences for curated sets of mutations to differentiate them from antibiotic susceptible wild-type alleles. PVMs are designed to detect AMR acquired via mutation of house-keeping genes or antibiotic targets, e.g. a mutated gyrase resistant to aminocoumarin antibiotics. PVMs include a protein reference sequence (often from antibiotic susceptible wild-type alleles), a curated bit-score cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of single point mutations, insertions, or deletions curated from the scientific literature. A Strict RGI match has a BLASTP bit-score above the curated BLASTP cutoff value and contains at least one curated mutation from amongst the mapped resistance variants, while a Loose RGI match has a bit-score less than the curated BLASTP bit-score cut-off but still contains at least one curated mutation from amongst the mapped resistance variants.

Bit-score Cut-off (blastP): 725

PubMed: mutation data hand curated from the scientific literature, evaluated as conferring resistance (R). CRyPTIC: mutation data acquired from the CRyPTIC catalog, evaluated as resistant (R), susceptible (S), or undetermined (U). ReSeqTB: mutation data acquired from the ReSeqTB catalog, evaluated as conferring resistance (Minimal, Moderate, High), not conferring resistance (None), or Indeterminate. WHO: mutation data acquired from the WHO 2023 catalog, evaluated as resistant (R), susceptible (S), or undetermined (U).

MutationMutation typePubMedReSeqTBCRyPTICWHO
-10g>anucleotide substitution in promoter regionno datano dataCRyPTIC-RWHO-R
-12c>tnucleotide substitution in promoter regionno datano dataCRyPTIC-UWHO-R
-14c>tnucleotide substitution in promoter regionno datano dataCRyPTIC-RWHO-R
-37g>tnucleotide substitution in promoter regionno datano dataCRyPTIC-UWHO-R
V163Isingle resistance variantno dataReSeqTB-Highno dataWHO-S

>gb|NP_216932.2|-|Mycobacterium tuberculosis eis with mutation conferring resistance to kanamycin [Mycobacterium tuberculosis H37Rv]
MTVTLCSPTEDDWPGMFLLAAASFTDFIGPESATAWRTLVPTDGAVVVRDGAGPGSEVVG
MALYMDLRLTVPGEVVLPTAGLSFVAVAPTHRRRGLLRAMCAELHRRIADSGYPVAALHA
SEGGIYGRFGYGPATTLHELTVDRRFARFHADAPGGGLGGSSVRLVRPTEHRGEFEAIYE
RWRQQVPGGLLRPQVLWDELLAECKAAPGGDRESFALLHPDGYALYRVDRTDLKLARVSE
LRAVTADAHCALWRALIGLDSMERISIITHPQDPLPHLLTDTRLARTTWRQDGLWLRIMN
VPAALEARGYAHEVGEFSTVLEVSDGGRFALKIGDGRARCTPTDAAAEIEMDRDVLGSLY
LGAHRASTLAAANRLRTKDSQLLRRLDAAFASDVPVQTAFEF



>gb|NC_000962.3|-|2714124-2715332|Mycobacterium tuberculosis eis with mutation conferring resistance to kanamycin [Mycobacterium tuberculosis H37Rv]
GTGACTGTGACCCTGTGTAGCCCGACCGAGGACGACTGGCCGGGGATGTTCCTACTGGCCGCGGCCAGTTTCACCGATTTCATCGGCCCT
GAATCAGCGACCGCCTGGCGGACCCTGGTGCCCACCGACGGAGCGGTGGTGGTCCGCGATGGTGCCGGCCCGGGTTCTGAGGTGGTCGGG
ATGGCGCTGTACATGGATCTGCGGTTGACGGTGCCTGGTGAAGTGGTGCTCCCGACCGCCGGTCTCAGTTTCGTCGCGGTGGCGCCGACG
CATCGCCGGCGCGGCTTGCTGCGCGCGATGTGCGCCGAACTGCACCGCCGCATAGCCGATTCCGGCTATCCGGTCGCGGCACTGCATGCT
AGCGAGGGCGGCATCTACGGCCGGTTCGGCTACGGGCCCGCTACCACCTTGCATGAGCTGACGGTCGACCGACGCTTCGCGCGCTTTCAC
GCCGACGCACCGGGCGGCGGCCTAGGTGGCAGCAGCGTCCGGTTGGTCAGACCCACCGAGCATCGCGGCGAGTTTGAGGCGATCTACGAG
CGATGGCGCCAGCAGGTGCCGGGCGGGCTGCTACGCCCGCAGGTGCTCTGGGACGAGCTGCTGGCAGAATGCAAAGCCGCGCCCGGTGGA
GACCGTGAATCGTTCGCGTTACTGCATCCCGACGGGTACGCGCTGTACCGGGTGGATCGCACCGATCTCAAGCTAGCGCGCGTCAGCGAA
CTCAGGGCGGTAACCGCAGATGCGCATTGTGCGTTGTGGCGGGCCCTGATTGGCCTCGACTCCATGGAGCGAATCAGCATCATCACCCAT
CCACAGGACCCGTTACCCCACCTGCTCACCGATACCCGACTGGCCCGCACTACCTGGCGCCAGGACGGCCTGTGGTTGCGCATCATGAAC
GTACCGGCCGCACTCGAGGCGCGTGGTTACGCTCACGAAGTTGGCGAGTTTTCCACGGTCCTCGAGGTATCCGATGGCGGCCGGTTCGCG
CTCAAGATCGGTGACGGCCGTGCGCGGTGTACCCCGACCGATGCGGCAGCCGAGATCGAAATGGATCGGGACGTACTGGGCAGCCTTTAC
CTTGGAGCGCACCGCGCTTCGACGTTAGCCGCCGCTAACCGGTTGCGCACCAAAGATTCCCAGCTGCTTCGTCGACTCGACGCGGCGTTT
GCCAGTGATGTTCCCGTCCAGACCGCGTTCGAGTTCTGA

Curator Acknowledgements
Curator Description Most Recent Edit