BLMT

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3005036
CARD Short NameBLMT
DefinitionBLMT is a bleomycin (Bm) resistance protein, encoded by the ble gene on the transposon Tn5. This protein confers a survival advantage to Escherichia coli host cells. BLMT confers resistance to bleomycin.
AMR Gene FamilyBleomycin resistant protein
Drug Classpeptide antibiotic, nonribosomal peptide antibiotics, glycopeptide antibiotic
Resistance Mechanismantibiotic inactivation
Classification10 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic bleomycin [Antibiotic]
+ Bleomycin resistant protein [AMR Gene Family]
Resistomes with Perfect MatchesAcinetobacter lwoffiiwgs, Aeromonas caviaewgs, Burkholderia multivoranswgs, Enterobacter hormaecheiwgs, Escherichia coliwgs, Klebsiella pneumoniaewgs, Pseudomonas aeruginosag+wgs, Pseudomonas putidawgs, Salmonella entericawgs, Shigella sonneiwgs
Resistomes with Sequence VariantsAcinetobacter lwoffiiwgs, Aeromonas caviaewgs, Burkholderia glumaeg, Burkholderia multivoranswgs, Enterobacter hormaecheiwgs, Escherichia coliwgs, Klebsiella pneumoniaewgs, Phocaeicola doreiwgs, Pseudomonas aeruginosag+p+wgs, Pseudomonas putidawgs, Salmonella entericawgs, Shigella sonneiwgs
Publications

Kumagai T, et al. 1999. FEBS Lett 442(1):34-8 Characterization of the bleomycin resistance determinant encoded on the transposon Tn5. (PMID 9923599)

Resistomes

Prevalence of BLMT among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter lwoffii0%0%2.63%0%0%
Aeromonas caviae0%0%0.54%0%0%
Burkholderia glumae1%0%0%0%0%
Burkholderia multivorans0%0%0.24%0%0%
Enterobacter hormaechei0%0%0.04%0%0%
Escherichia coli0%0%0.29%0%0.75%
Klebsiella pneumoniae0%0%0.02%0%0%
Phocaeicola dorei0%0%1.04%0%0%
Pseudomonas aeruginosa0.61%0.29%0.83%0%0%
Pseudomonas putida0%0%0.53%0%0%
Salmonella enterica0%0%0.52%0%0%
Shigella sonnei0%0%0.15%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 200


>gb|BAF34030.1|+|BLMT [Escherichia coli]
MTDQATPNLPSRDFDSTAAFYERLGFGIVFRDAGWMILQRGDLMLEFFAHPGLDPLASWFSCCLRLDDLAEFYRQCKSVGIQETSSGYPR
IHAPELQEWGGTMAALVDPDGTLLRLIQNELLAGIS


>gb|AB255435.1|+|117277-117657|BLMT [Escherichia coli]
ATGACCGACCAAGCGACGCCCAACCTGCCATCACGAGATTTCGATTCCACCGCCGCCTTCTATGAAAGGTTGGGCTTCGGAATCGTTTTC
CGGGACGCCGGCTGGATGATCCTCCAGCGCGGGGATCTCATGCTGGAGTTCTTCGCCCACCCCGGGCTCGATCCCCTCGCGAGTTGGTTC
AGCTGCTGCCTGAGGCTGGACGACCTCGCGGAGTTCTACCGGCAGTGCAAATCCGTCGGCATCCAGGAAACCAGCAGCGGCTATCCGCGC
ATCCATGCCCCCGAACTGCAGGAGTGGGGAGGCACGATGGCCGCTTTGGTCGACCCGGACGGGACGCTCCTGCGCCTGATACAGAACGAA
TTGCTTGCAGGCATCTCATGA

Curator Acknowledgements
Curator Description Most Recent Edit