ThfT

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3007427
CARD Short NameThfT
DefinitionThfT is an ECF transporter S component that expands the substrate profile of endogenous ECF transporters to include folate biosynthesis end products. It confers resistance to the folate synthesis inhibitor sulfamethoxazole by allowing uptake of host folate.
AMR Gene FamilyECF transporter S component
Drug Classsulfonamide antibiotic
Resistance Mechanismresistance by host-dependent nutrient acquisition
Classification7 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic sulfamethoxazole [Antibiotic]
+ ECF transporter S component [AMR Gene Family]
Resistomes with Perfect MatchesStreptococcus dysgalactiaewgs, Streptococcus pyogenesg+wgs
Resistomes with Sequence VariantsStreptococcus dysgalactiaeg+wgs, Streptococcus pyogenesg+wgs
Publications

Rodrigo MKD, et al. 2022. Nat Commun 13(1):6557 Host-dependent resistance of Group A Streptococcus to sulfamethoxazole mediated by a horizontally-acquired reduced folate transporter. (PMID 36450721)

Resistomes

Prevalence of ThfT among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Streptococcus dysgalactiae2%0%1.87%0%0%
Streptococcus pyogenes0.75%0%0.72%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300


>gb|QCK45398.1|-|ThfT [Streptococcus pyogenes]
MSPIFNGPKMSVQRLVSIAMLIALTLVISKFSIPVIPQQLVISFAFIGNTMIGMIAGPIWAFISLALVDVTDNLASGSGNFIIWWTLMEA
VQGLLYGFFFYRKPLSTANKKDWLYVSLATIIIMLFGTFIFTPLLIQIYFHVPFWAQYAAGRWFKVFEIPLRVVITMLLVPALQRIPEIK
KLNQA


>gb|CP035438.1|-|631753-632310|ThfT [Streptococcus pyogenes]
ATGTCACCTATTTTTAATGGACCAAAAATGTCCGTTCAACGTCTTGTCTCTATCGCTATGCTAATTGCCCTAACCCTAGTCATTAGCAAA
TTTTCAATACCAGTTATTCCGCAACAATTGGTTATTAGTTTTGCCTTTATCGGTAATACCATGATTGGCATGATTGCTGGTCCAATTTGG
GCTTTTATTTCCCTAGCCCTAGTTGATGTGACTGATAACCTAGCCAGTGGGTCAGGTAATTTCATCATTTGGTGGACCCTAATGGAGGCT
GTTCAGGGGCTCTTGTATGGTTTTTTCTTCTACCGGAAACCACTGTCAACAGCCAATAAAAAAGACTGGCTTTATGTTAGCCTAGCAACA
ATTATCATCATGTTGTTTGGAACCTTCATCTTTACACCTCTTTTGATTCAAATCTACTTCCATGTCCCATTTTGGGCTCAATATGCAGCA
GGAAGATGGTTTAAAGTCTTTGAAATCCCTCTTCGGGTCGTTATCACCATGTTATTAGTGCCAGCCCTTCAAAGAATACCTGAAATCAAA
AAATTAAATCAAGCCTAA

Curator Acknowledgements
Curator Description Most Recent Edit