tet(B)

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3000166
Synonym(s)tetB
CARD Short Nametet(B)
DefinitionTet(B) is a tetracycline efflux protein expressed in many Gram-negative bacteria. It confers resistance to tetracycline, doxycycline, and minocycline, but not tigecycline.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classtetracycline antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEscherichia coli (24), Salmonella (8), Acinetobacter baumannii (7), Clostridium perfringens (6), Shigella (5), Acinetobacter (2), Listeria monocytogenes (2), Citrobacter (2), Actinobacillus pleuropneumoniae (2), Shigella flexneri (2)
GAZ
FOODONwater food product (9), swine (5), Bos taurus (3), dairy cow (3), chipped beef (2), chicken (2), fish (2), food product for animal (2), meat (skinless) (2), poultry drumstick (2)
ENVOfarm (5), landlocked sea (2), large river delta biome (2)
UBERONfeces (3), membrane organ (3), animal hemisphere (3), proliferative region (3)
Classification7 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic tetracycline [Antibiotic]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
Resistomes with Sequence VariantsAcinetobacter baumanniig+p+wgs+gi, Acinetobacter nosocomialiswgs, Acinetobacter radioresistenswgs, Actinobacillus indolicusg+gi, Actinobacillus pleuropneumoniaeg+wgs+gi, Actinobacillus porcitonsillarumg+gi, Avibacterium paragallinarumg+wgs+gi, Citrobacter amalonaticuswgs, Citrobacter freundiig+wgs, Citrobacter koseriwgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Cronobacter sakazakiiwgs, Enterobacter asburiaep+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiiwgs, Escherichia albertiig+wgs, Escherichia colig+p+wgs+gi, Escherichia fergusoniig+p+wgs+gi, Glaesserella parasuisg+wgs, Haemophilus influenzaeg+wgs+gi, Haemophilus parainfluenzaeg+wgs, Kingella kingaegi, Klebsiella aerogeneswgs, Klebsiella michiganensisg+p+wgs, Klebsiella oxytocawgs, Klebsiella pneumoniaeg+p+wgs+gi, Klebsiella quasipneumoniaewgs, Leclercia adecarboxylatawgs, Morganella morganiig+wgs+gi, Neisseria meningitidisg+wgs, Pasteurella multocidag+wgs+gi, Proteus columbaeg, Proteus mirabilisg+p+wgs, Proteus pennerig+wgs, Proteus vulgarisp+wgs, Providencia alcalifaciensg+wgs, Providencia rettgerig+wgs, Providencia stuartiig+wgs, Salmonella entericag+p+wgs+gi, Serratia marcescenswgs, Shigella boydiig+wgs, Shigella dysenteriaeg+p+wgs+gi, Shigella flexnerig+p+wgs+gi, Shigella sonneip+wgs, Vibrio alginolyticuswgs, Vibrio choleraep+wgs, Vibrio harveyip+wgs, Vibrio owensiig+gi, Vibrio parahaemolyticusg+p+wgs+gi, Vibrio vulnificuswgs
Publications

Roberts MC. 2005. FEMS Microbiol Lett 245(2): 195-203. Update on acquired tetracycline resistance genes. (PMID 15837373)

Resistomes

Prevalence of tet(B) among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii40.53%0.99%54.43%27.04%0%
Acinetobacter nosocomialis0%0%1.15%0%0%
Acinetobacter radioresistens0%0%3.51%0%0%
Actinobacillus indolicus100%0%0%100%0%
Actinobacillus pleuropneumoniae16.67%0%19.05%100%0%
Actinobacillus porcitonsillarum100%0%0%100%0%
Avibacterium paragallinarum50%0%64.71%100%0%
Citrobacter amalonaticus0%0%1.82%0%0%
Citrobacter freundii0.82%0%5.22%0%0%
Citrobacter koseri0%0%1.8%0%0%
Citrobacter portucalensis0%0%0.9%0%0%
Citrobacter werkmanii0%0%7.69%0%0%
Cronobacter sakazakii0%0%0.22%0%0%
Enterobacter asburiae0%0.83%1.98%0%0%
Enterobacter chengduensis0%0%4%0%0%
Enterobacter cloacae0%0.56%3.51%0%0%
Enterobacter hormaechei1.44%3.6%7.81%0%0%
Enterobacter kobei0%0.69%1.75%0%0%
Enterobacter roggenkampii0%0%1.8%0%0%
Escherichia albertii7.14%0%7.74%0%0%
Escherichia coli4.14%1.72%15.84%2.81%20.43%
Escherichia fergusonii6.56%3.91%10.87%100%0%
Glaesserella parasuis38.46%0%30.77%0%0%
Haemophilus influenzae1.03%0%1.07%25%0%
Haemophilus parainfluenzae6.25%0%7.32%0%0%
Kingella kingae0%0%0%100%0%
Klebsiella aerogenes0%0%0.28%0%0%
Klebsiella michiganensis9.68%2.29%1.6%0%0%
Klebsiella oxytoca0%0%3.78%0%0%
Klebsiella pneumoniae0.24%0.21%2.17%0.95%0%
Klebsiella quasipneumoniae0%0%0.79%0%0%
Leclercia adecarboxylata0%0%4.65%0%0%
Morganella morganii46.15%0%41.1%23.08%0%
Neisseria meningitidis1.53%0%7.23%0%0%
Pasteurella multocida12.86%0%11.99%50%0%
Proteus columbae100%0%0%0%0%
Proteus mirabilis0.92%2.5%1.82%0%0%
Proteus penneri50%0%12.5%0%0%
Proteus vulgaris0%22.22%16.67%0%0%
Providencia alcalifaciens18.18%0%3.45%0%0%
Providencia rettgeri2.94%0%23.57%0%0%
Providencia stuartii75%0%86.36%0%0%
Salmonella enterica6.94%3.17%11.69%12.25%0%
Serratia marcescens0%0%0.13%0%0%
Shigella boydii6.67%0%16.67%0%0%
Shigella dysenteriae21.43%4.55%26.67%25%0%
Shigella flexneri47%0.8%80.9%23.81%0%
Shigella sonnei0%0.97%13.88%0%0%
Vibrio alginolyticus0%0%1.19%0%0%
Vibrio cholerae0%10.53%0.06%0%0%
Vibrio harveyi0%14.29%4%0%0%
Vibrio owensii8.33%0%0%50%0%
Vibrio parahaemolyticus1.62%1.86%2.06%100%0%
Vibrio vulnificus0%0%1.22%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 700


>gb|BAC67143.1|+|tet(B) [Gram-negative bacterium TC71]
MNSSTKIALAITLLDAMGIGLIMPVLPTLLREFIASEDIANHFGVLLALYALMQVIFAPWLGKMSDRFGRRPVLLLSLIGASLDYLLLAF
SSALWMLYLGRLLSGITGATGAVAASVIADTTSASQRVKWFGWLGASFGLGLIAGPIIGGFAGEISPHSPFFIAALLNIVTFLVVMFWFR
ETKNTRDNTDTEVGVETQSNSVYITLFKTMPILLIIYFSAQLIGQIPATVWVLFTENRFGWNSMMVGFSLAGLGLLHSVFQAFVAGRIAT
KWGEKTAVLLGFIADSSAFAFLAFISEGWLVFPVLILLAGGGIALPALQGVMSIQTKSHQQGALQGLLVSLNNATGVIGPLLFAVIYNHS
LPIWDGWIWIIGLAFYCIIILLSMTFMLTPQAQGSKQETSA


>gb|AB089595.1|+|1-1206|tet(B) [Gram-negative bacterium TC71]
ATGAATAGTTCGACAAAGATCGCATTGGCAATTACGTTACTCGATGCCATGGGGATTGGCCTTATCATGCCAGTCTTGCCAACGTTATTA
CGTGAATTTATTGCTTCGGAAGATATCGCTAACCACTTTGGCGTATTGCTTGCACTTTATGCGTTAATGCAGGTTATCTTTGCTCCTTGG
CTTGGAAAAATGTCTGACCGATTTGGTCGGCGCCCAGTGCTGTTGTTGTCATTAATAGGCGCATCGCTGGATTACTTATTGCTGGCTTTT
TCAAGTGCGCTTTGGATGCTGTATTTAGGCCGTTTGCTTTCAGGGATCACAGGAGCTACTGGGGCTGTCGCGGCATCGGTCATTGCCGAT
ACCACCTCAGCTTCTCAACGCGTGAAGTGGTTCGGTTGGTTAGGGGCAAGTTTTGGGCTTGGTTTAATAGCGGGGCCTATTATTGGTGGT
TTTGCAGGAGAGATTTCACCGCATAGTCCCTTTTTTATCGCTGCGTTGCTAAATATTGTCACTTTCCTTGTGGTTATGTTTTGGTTCCGT
GAAACCAAAAATACACGTGATAATACAGATACCGAAGTAGGGGTTGAGACGCAATCGAATTCGGTATACATCACTTTATTTAAAACGATG
CCCATTTTGTTGATTATTTATTTTTCAGCGCAATTGATAGGCCAAATTCCCGCAACGGTGTGGGTGCTATTTACCGAAAATCGTTTTGGA
TGGAATAGCATGATGGTTGGCTTTTCATTAGCGGGTCTTGGTCTTTTACACTCAGTATTCCAAGCCTTTGTGGCAGGAAGAATAGCCACT
AAATGGGGCGAAAAAACGGCAGTACTGCTCGGATTTATTGCAGATAGTAGTGCATTTGCCTTTTTAGCGTTTATATCTGAAGGTTGGTTA
GTTTTCCCTGTTTTAATTTTATTGGCTGGTGGTGGGATCGCTTTACCTGCATTACAGGGAGTGATGTCTATCCAAACAAAGAGTCATCAG
CAAGGTGCTTTACAGGGATTATTGGTGAGCCTTAACAATGCAACCGGTGTTATTGGCCCATTACTGTTTGCTGTTATTTATAATCATTCA
CTACCAATTTGGGATGGCTGGATTTGGATTATTGGTTTAGCGTTTTACTGTATTATTATCCTGCTATCGATGACCTTCATGTTAACCCCT
CAAGCTCAGGGGAGTAAACAGGAGACAAGTGCTTAG

Curator Acknowledgements
Curator Description Most Recent Edit