tet(D)

Accession ARO:3000168
Synonym(s)tetD
DefinitionTetD is a tetracycline efflux pump found exclusively in Gram-negative bacteria.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classtetracycline antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesCitrobacter freundiip+wgs, Citrobacter youngaewgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeip+wgs, Escherichia colig+p+wgs, Klebsiella aerogeneswgs, Klebsiella oxytocawgs, Klebsiella pneumoniaeg+p+wgs, Morganella morganiip, Proteus mirabilisg+p, Salmonella entericag+p+wgs, Serratia marcescenswgs, Vibrio choleraewgs
Classification7 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic tetracycline [Antibiotic]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
Publications

Roberts MC. 2005. FEMS Microbiol Lett 245(2): 195-203. Update on acquired tetracycline resistance genes. (PMID 15837373)

Resistomes

Prevalence of tet(D) among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Achromobacter xylosoxidans78.57%0%60%
Acinetobacter baumannii2.72%1.18%1.85%
Acinetobacter haemolyticus0%2.44%0%
Acinetobacter nosocomialis0%1.92%7.69%
Burkholderia cenocepacia32.76%0%91.01%
Burkholderia cepacia31.25%0%97.62%
Citrobacter freundii0%5.66%5.73%
Citrobacter youngae0%0%12.5%
Enterobacter asburiae0%0%1.19%
Enterobacter cloacae0%3.45%3.71%
Enterobacter hormaechei1.61%11.54%10.64%
Enterobacter kobei0%5.56%5.8%
Escherichia coli0.22%0.05%1.03%
Klebsiella aerogenes0%0%2.35%
Klebsiella oxytoca0%0%2.72%
Klebsiella pneumoniae0.2%1.41%10.11%
Morganella morganii11.76%5.26%21.43%
Proteus mirabilis100%8.33%96.65%
Proteus penneri0%0%0%
Proteus vulgaris75%0%80%
Providencia stuartii0%0%20.83%
Pseudomonas aeruginosa6.13%9.62%3.2%
Pseudomonas putida0%0%3.12%
Pseudomonas stutzeri0%0%1.39%
Ralstonia mannitolilytica16.67%0%12.5%
Ralstonia pickettii16.67%0%7.69%
Raoultella planticola83.33%5.88%92.86%
Salmonella enterica2.19%0.27%4.03%
Serratia marcescens16.13%0%14.94%
Shigella flexneri0%0%1.83%
Shigella sonnei0%1.61%0.62%
Stenotrophomonas maltophilia0%0%0.26%
Vibrio cholerae0.8%0%2.44%
Vibrio parahaemolyticus0%0.41%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 250


>gb|AAL75563.1|+|tet(D) [Shigella flexneri Y]
MNKPAVIALVITLLDAMGIGLIMPVLPSLLREYLPEADVANHYGILLALYAVMQVCFAPLLGRWSDKLGRRPVLLLSLAGAAFDYTLLAL
SNVLWMLYLGRIISGITGATGAVAASVVADSTAVSERTAWFGRLGAAFGAGLIAGPAIGGLAGDISPHLPFVIAAILNACTFLMVFFIFK
PAVQTEEKPAEQKQESAGISFITLLKPLALLLFVFFTAQLIGQIPATVWVLFTESRFAWDSAAVGFSLAGLGAMHALFQAVVAGALAKRL
SEKTIIFAGFIADATAFLLMSAITSGWMVYPVLILLAGGGIALPALQGIISAGASAANQGKLQGVLVSLTNLTGVAGPLLFAFIFSQTQQ
SADGTVWLIGTALYGLLLAICLLIRKPAPVAATC


>gb|AF467077.1|+|164-1348|tet(D) [Shigella flexneri Y]
ATGAATAAACCCGCTGTCATCGCGCTGGTGATTACACTGCTGGACGCGATGGGAATTGGTCTGATCATGCCGGTATTACCGTCACTGCTG
CGGGAATATCTCCCGGAAGCGGATGTGGCAAACCATTACGGCATTCTGCTGGCGCTGTATGCGGTGATGCAGGTCTGTTTTGCTCCGCTG
CTGGGCAGATGGTCAGATAAGCTGGGGCGCAGACCGGTGCTGCTGTTATCCCTGGCGGGTGCCGCGTTTGATTACACACTGCTGGCACTG
TCCAATGTGCTGTGGATGTTGTATCTCGGGCGGATTATCTCCGGGATCACTGGTGCCACCGGCGCGGTTGCGGCTTCGGTAGTGGCGGAC
AGCACGGCGGTCAGCGAGCGTACCGCCTGGTTCGGCCGTCTCGGTGCGGCCTTTGGTGCCGGGCTGATTGCCGGGCCGGCTATCGGCGGA
CTGGCGGGGGATATCTCACCGCATCTGCCGTTTGTCATTGCGGCAATACTGAATGCCTGCACCTTTCTGATGGTCTTTTTTATCTTTAAA
CCGGCGGTACAGACAGAAGAAAAACCGGCGGAGCAGAAACAAGAAAGCGCAGGTATCAGCTTTATCACACTGCTTAAACCTCTGGCGCTG
TTGCTGTTTGTCTTTTTTACCGCGCAGCTTATCGGGCAGATCCCGGCCACTGTCTGGGTATTGTTTACGGAGAGCCGCTTTGCCTGGGAC
AGCGCGGCGGTCGGTTTTTCACTGGCGGGACTCGGGGCGATGCATGCACTGTTTCAGGCGGTGGTTGCCGGGGCGCTGGCAAAACGGCTG
AGTGAGAAAACCATTATTTTCGCCGGATTTATTGCCGATGCCACCGCGTTTTTACTGATGTCTGCTATCACTTCCGGATGGATGGTGTAT
CCGGTCCTGATCCTGCTGGCAGGCGGCGGAATTGCACTGCCTGCATTGCAGGGCATTATCTCTGCCGGGGCATCGGCGGCAAATCAGGGA
AAACTACAGGGTGTGCTGGTCAGCCTGACCAATCTGACCGGCGTGGCGGGCCCGCTGCTGTTTGCTTTTATTTTCAGTCAGACACAGCAG
AGTGCGGACGGTACGGTGTGGCTGATTGGCACGGCACTGTACGGTCTGCTGCTGGCAATCTGTCTGCTGATCAGAAAACCGGCACCGGTG
GCGGCCACCTGCTGA