tet(K)

Download Sequences

Accession	ARO:3000178
Synonym(s)	tetK
CARD Short Name	tet(K)
Definition	TetK is a tetracycline efflux protein found in both Gram-negative (Haemophilus and Gallibacterium) and Gram-positive (many species, including mycobacteria) bacteria.
AMR Gene Family	major facilitator superfamily (MFS) antibiotic efflux pump
Drug Class	tetracycline antibiotic
Resistance Mechanism	antibiotic efflux
Efflux Component	efflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect Matches	Enterococcus faecalis^wgs, Listeria innocua^wgs, Listeria monocytogenes^wgs, Pseudomonas aeruginosa^p, Shigella flexneri^wgs, Staphylococcus arlettae^wgs, Staphylococcus aureus^g+p+wgs+gi, Staphylococcus capitis^p+wgs, Staphylococcus epidermidis^g+p+wgs+gi, Staphylococcus equorum^p+wgs, Staphylococcus haemolyticus^g+p+wgs, Staphylococcus hominis^p+wgs, Staphylococcus pasteuri^p+wgs, Staphylococcus pseudintermedius^wgs, Staphylococcus saprophyticus^p+wgs, Staphylococcus simulans^p+wgs, Staphylococcus warneri^p+wgs, Streptococcus pneumoniae^wgs
Resistomes with Sequence Variants	Enterococcus faecalis^wgs, Listeria innocua^wgs, Listeria monocytogenes^wgs, Pseudomonas aeruginosa^p, Shigella flexneri^wgs, Staphylococcus arlettae^wgs, Staphylococcus aureus^g+p+wgs+gi, Staphylococcus capitis^p+wgs, Staphylococcus epidermidis^g+p+wgs+gi, Staphylococcus equorum^p+wgs, Staphylococcus haemolyticus^g+p+wgs, Staphylococcus hominis^p+wgs, Staphylococcus pasteuri^p+wgs, Staphylococcus pseudintermedius^wgs, Staphylococcus saprophyticus^p+wgs, Staphylococcus simulans^p+wgs, Staphylococcus warneri^p+wgs, Streptococcus pneumoniae^wgs
Classification	7 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + antibiotic efflux [Resistance Mechanism] + determinant of antibiotic resistance + antibiotic molecule + efflux pump complex or subunit conferring antibiotic resistance [Efflux Component] + tetracycline antibiotic [Drug Class]
Parent Term(s)	2 ontology terms \| Show + major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family] + confers_resistance_to_antibiotic tetracycline [Antibiotic]
Publications	Roberts MC. 2005. FEMS Microbiol Lett 245(2): 195-203. Update on acquired tetracycline resistance genes. (PMID 15837373) Yamaguchi A, et al. 1995. FEBS Lett 365(2-3): 193-197. The tetracycline efflux protein encoded by the tet(K) gene from Staphylococcus aureus is a metal-tetracycline/H+ antiporter. (PMID 7781778) Guay GG, et al. 1993. Plasmid 30(2): 163-166. The tet(K) gene of plasmid pT181 of Staphylococcus aureus encodes an efflux protein that contains 14 transmembrane helices. (PMID 8234490)

Resistomes

Prevalence of tet(K) among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI
Enterococcus faecalis	0%	0%	0.04%	0%
Enterococcus faecalis	0%	0%	0.04%	0%
Listeria innocua	0%	0%	0.75%	0%
Listeria innocua	0%	0%	0.75%	0%
Listeria monocytogenes	0%	0%	0.02%	0%
Listeria monocytogenes	0%	0%	0.02%	0%
Pseudomonas aeruginosa	0%	0.29%	0%	0%
Pseudomonas aeruginosa	0%	0.29%	0%	0%
Shigella flexneri	0%	0%	0.16%	0%
Shigella flexneri	0%	0%	0.16%	0%
Staphylococcus arlettae	0%	0%	15%	0%
Staphylococcus arlettae	0%	0%	15%	0%
Staphylococcus aureus	5.15%	1.6%	5.29%	2.01%
Staphylococcus aureus	5.15%	1.6%	5.35%	2.29%
Staphylococcus capitis	0%	5.26%	3.16%	0%
Staphylococcus capitis	0%	5.26%	3.16%	0%
Staphylococcus epidermidis	3.87%	4.32%	7.2%	2.86%
Staphylococcus epidermidis	3.87%	4.61%	7.36%	2.86%
Staphylococcus equorum	0%	8.11%	7.14%	0%
Staphylococcus equorum	0%	8.11%	7.14%	0%
Staphylococcus haemolyticus	6.9%	1.89%	14.51%	0%
Staphylococcus haemolyticus	6.9%	1.89%	14.51%	0%
Staphylococcus hominis	0%	4.17%	10.73%	0%
Staphylococcus hominis	0%	4.17%	10.73%	0%
Staphylococcus pasteuri	0%	11.76%	15.38%	0%
Staphylococcus pasteuri	0%	11.76%	15.38%	0%
Staphylococcus pseudintermedius	0%	0%	4.87%	0%
Staphylococcus pseudintermedius	0%	0%	4.87%	0%
Staphylococcus saprophyticus	0%	2.7%	11.89%	0%
Staphylococcus saprophyticus	0%	2.7%	11.89%	0%
Staphylococcus simulans	0%	5.88%	6.78%	0%
Staphylococcus simulans	0%	5.88%	6.78%	0%
Staphylococcus warneri	0%	2.5%	5.74%	0%
Staphylococcus warneri	0%	2.5%	6.56%	0%
Streptococcus pneumoniae	0%	0%	0.01%	0%
Streptococcus pneumoniae	0%	0%	0.01%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 850

Protein
DNA

>gb|AAB28795.1|+|tet(K) [Staphylococcus aureus]
MFSLYKKFKGLFYSVLFWLCILSFFSVLNEMVLNVSLPDIANHFNTTPGITNWVNTAYMLTFSIGTAVYGKLSDYINIKKLLIIGISLSC
LGSLIAFIGHNHFFILIFGRLVQGVGSAAFPSLIMVVVARNITRKKQGKAFGFIGSIVALGEGLGPSIGGIIAHYIHWSYLLILPMITIV
TIPFLIKVMVPGKSTKNTLDIVGIVLMSISIICFMLFTTNYNWTFLILFTIFFVIFIKHISRVSNPFINPKLGKNIPFMLGLFSGGLIFS
IVAGFISMVPYMMKTIYHVNVATIGNSVIFPGTMSVIVFGYFGGFLVDRKGSLFVFILGSLSISISFLTIAFFVEFSMWLTTFMFIFVMG
GLSFTKTVISKIVSSSLSEEEVASGMSLLNFTSFLSEGTGIAIVGGLLSLQLINRKLVLEFINYSSGVYSNILVAMAILIILCCLLTIIV
FKRSEKQFE

>gb|S67449.1|+|1-1380|tet(K) [Staphylococcus aureus]
TTGTTTAGTTTATATAAAAAATTTAAAGGTTTGTTTTATAGCGTTTTATTTTGGCTTTGTATTCTTTCATTTTTTAGTGTATTAAATGAA
ATGGTTTTAAATGTTTCTTTACCTGATATTGCAAATCATTTTAATACTACTCCTGGAATTACAAACTGGGTAAACACTGCATATATGTTA
ACTTTTTCGATAGGAACAGCAGTATATGGAAAATTATCTGATTATATAAATATAAAAAAATTGTTAATTATTGGTATTAGTTTGAGCTGT
CTTGGTTCATTGATTGCTTTTATTGGTCACAATCACTTTTTTATTTTGATTTTTGGTAGGTTAGTACAAGGAGTAGGATCTGCTGCATTC
CCTTCACTGATTATGGTGGTTGTAGCTAGAAATATTACAAGAAAAAAACAAGGCAAAGCCTTTGGTTTTATAGGATCAATTGTAGCTTTA
GGTGAAGGGTTAGGTCCTTCAATAGGGGGAATAATAGCACATTATATTCATTGGTCTTACCTACTTATACTTCCTATGATTACAATAGTA
ACTATACCTTTTCTTATTAAAGTAATGGTACCTGGTAAATCAACAAAAAATACATTAGATATCGTAGGTATTGTTTTAATGTCTATAAGT
ATTATATGTTTTATGTTATTTACGACAAATTATAATTGGACTTTTTTAATACTCTTCACAATCTTTTTTGTGATTTTTATTAAACATATT
TCAAGAGTTTCTAACCCTTTTATTAATCCTAAACTAGGGAAAAACATTCCGTTTATGCTTGGTTTGTTTTCTGGTGGGCTAATATTTTCT
ATAGTAGCTGGTTTTATATCAATGGTGCCTTATATGATGAAAACTATTTATCATGTAAATGTAGCGACAATAGGTAATAGTGTTATTTTT
CCTGGAACCATGAGTGTTATTGTTTTTGGTTATTTTGGTGGTTTTTTAGTGGATAGAAAAGGATCATTATTTGTTTTTATTTTAGGATCA
TTGTCTATCTCTATAAGTTTTTTAACTATTGCATTTTTTGTTGAGTTTAGTATGTGGTTGACTACTTTTATGTTTATATTTGTTATGGGC
GGATTATCTTTTACTAAAACAGTTATATCAAAAATAGTATCAAGTAGTCTTTCTGAAGAAGAAGTTGCTTCTGGAATGAGTTTGCTAAAT
TTCACAAGTTTTTTATCAGAGGGAACAGGTATAGCAATTGTAGGAGGTTTATTGTCACTACAATTGATTAATCGTAAACTAGTTCTGGAA
TTTATAAATTATTCTTCTGGAGTGTATAGTAATATTCTTGTAGCCATGGCTATCCTTATTATTTTATGTTGTCTTTTGACGATTATTGTA
TTTAAACGTTCTGAAAAGCAGTTTGAATAG

tet(K)

Prevalence: protein homolog model (view sequences)

Graph