tet(K)

Accession ARO:3000178
Synonym(s)tetK
DefinitionTetK is a tetracycline efflux protein found in both Gram-negative (Haemophilus and Gallibacterium) and Gram-positive (many species, including mycobacteria) bacteria.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classtetracycline antibiotic, lincosamide antibiotic, rhodamine, penam, macrolide antibiotic, benzalkonium chloride, phenicol antibiotic, glycylcycline, antibacterial free fatty acids, isoniazid, fluoroquinolone antibiotic, acridine dye, peptide antibiotic, cephalosporin, bicyclomycin, rifamycin antibiotic, diaminopyrimidine antibiotic, fosfomycin, nitroimidazole antibiotic, oxazolidinone antibiotic, nucleoside antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesStaphylococcus aureusg+p+wgs, Staphylococcus epidermidisp+wgs, Staphylococcus pseudintermediuswgs, Streptococcus pneumoniaewgs
Classification30 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic tetracycline [Antibiotic]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
Publications

Roberts MC. 2005. FEMS Microbiol Lett 245(2): 195-203. Update on acquired tetracycline resistance genes. (PMID 15837373)

Yamaguchi A, et al. 1995. FEBS Lett 365(2-3): 193-197. The tetracycline efflux protein encoded by the tet(K) gene from Staphylococcus aureus is a metal-tetracycline/H+ antiporter. (PMID 7781778)

Guay GG, et al. 1993. Plasmid 30(2): 163-166. The tet(K) gene of plasmid pT181 of Staphylococcus aureus encodes an efflux protein that contains 14 transmembrane helices. (PMID 8234490)

Resistomes

Prevalence of tet(K) among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Listeria monocytogenes0%0%0.04%
Mycobacterium tuberculosis0%0%0.03%
Staphylococcus aureus9%2.26%9.81%
Staphylococcus epidermidis0%11.76%8.27%
Staphylococcus pseudintermedius0%0%9.14%
Streptococcus pneumoniae0%0%0.01%
Vibrio cholerae0%0%0.22%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 850


>gb|AAB28795.1|+|tet(K) [Staphylococcus aureus]
MFSLYKKFKGLFYSVLFWLCILSFFSVLNEMVLNVSLPDIANHFNTTPGITNWVNTAYMLTFSIGTAVYGKLSDYINIKKLLIIGISLSC
LGSLIAFIGHNHFFILIFGRLVQGVGSAAFPSLIMVVVARNITRKKQGKAFGFIGSIVALGEGLGPSIGGIIAHYIHWSYLLILPMITIV
TIPFLIKVMVPGKSTKNTLDIVGIVLMSISIICFMLFTTNYNWTFLILFTIFFVIFIKHISRVSNPFINPKLGKNIPFMLGLFSGGLIFS
IVAGFISMVPYMMKTIYHVNVATIGNSVIFPGTMSVIVFGYFGGFLVDRKGSLFVFILGSLSISISFLTIAFFVEFSMWLTTFMFIFVMG
GLSFTKTVISKIVSSSLSEEEVASGMSLLNFTSFLSEGTGIAIVGGLLSLQLINRKLVLEFINYSSGVYSNILVAMAILIILCCLLTIIV
FKRSEKQFE


>gb|S67449.1|+|1-1380|tet(K) [Staphylococcus aureus]
TTGTTTAGTTTATATAAAAAATTTAAAGGTTTGTTTTATAGCGTTTTATTTTGGCTTTGTATTCTTTCATTTTTTAGTGTATTAAATGAA
ATGGTTTTAAATGTTTCTTTACCTGATATTGCAAATCATTTTAATACTACTCCTGGAATTACAAACTGGGTAAACACTGCATATATGTTA
ACTTTTTCGATAGGAACAGCAGTATATGGAAAATTATCTGATTATATAAATATAAAAAAATTGTTAATTATTGGTATTAGTTTGAGCTGT
CTTGGTTCATTGATTGCTTTTATTGGTCACAATCACTTTTTTATTTTGATTTTTGGTAGGTTAGTACAAGGAGTAGGATCTGCTGCATTC
CCTTCACTGATTATGGTGGTTGTAGCTAGAAATATTACAAGAAAAAAACAAGGCAAAGCCTTTGGTTTTATAGGATCAATTGTAGCTTTA
GGTGAAGGGTTAGGTCCTTCAATAGGGGGAATAATAGCACATTATATTCATTGGTCTTACCTACTTATACTTCCTATGATTACAATAGTA
ACTATACCTTTTCTTATTAAAGTAATGGTACCTGGTAAATCAACAAAAAATACATTAGATATCGTAGGTATTGTTTTAATGTCTATAAGT
ATTATATGTTTTATGTTATTTACGACAAATTATAATTGGACTTTTTTAATACTCTTCACAATCTTTTTTGTGATTTTTATTAAACATATT
TCAAGAGTTTCTAACCCTTTTATTAATCCTAAACTAGGGAAAAACATTCCGTTTATGCTTGGTTTGTTTTCTGGTGGGCTAATATTTTCT
ATAGTAGCTGGTTTTATATCAATGGTGCCTTATATGATGAAAACTATTTATCATGTAAATGTAGCGACAATAGGTAATAGTGTTATTTTT
CCTGGAACCATGAGTGTTATTGTTTTTGGTTATTTTGGTGGTTTTTTAGTGGATAGAAAAGGATCATTATTTGTTTTTATTTTAGGATCA
TTGTCTATCTCTATAAGTTTTTTAACTATTGCATTTTTTGTTGAGTTTAGTATGTGGTTGACTACTTTTATGTTTATATTTGTTATGGGC
GGATTATCTTTTACTAAAACAGTTATATCAAAAATAGTATCAAGTAGTCTTTCTGAAGAAGAAGTTGCTTCTGGAATGAGTTTGCTAAAT
TTCACAAGTTTTTTATCAGAGGGAACAGGTATAGCAATTGTAGGAGGTTTATTGTCACTACAATTGATTAATCGTAAACTAGTTCTGGAA
TTTATAAATTATTCTTCTGGAGTGTATAGTAATATTCTTGTAGCCATGGCTATCCTTATTATTTTATGTTGTCTTTTGACGATTATTGTA
TTTAAACGTTCTGAAAAGCAGTTTGAATAG