tet(V)

Accession ARO:3000181
Synonym(s)tetV
DefinitionTetV is a tetracycline efflux protein that has been found in Mycolicibacterium smegmatis and Mycolicibacterium fortuitum.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classtetracycline antibiotic, rhodamine, phenicol antibiotic, antibacterial free fatty acids, glycylcycline, macrolide antibiotic, diaminopyrimidine antibiotic, fosfomycin, acridine dye, isoniazid, oxazolidinone antibiotic, peptide antibiotic, penam, bicyclomycin, benzalkonium chloride, nucleoside antibiotic, lincosamide antibiotic, cephalosporin, fluoroquinolone antibiotic, nitroimidazole antibiotic, rifamycin antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Classification30 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic tetracycline [Antibiotic]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
Publications

De Rossi E, et al. 1998. Antimicrob Agents Chemother 42(8): 1931-1937. Molecular cloning and functional analysis of a novel tetracycline resistance determinant, tet(V), from Mycobacterium smegmatis. (PMID 9687386)

Roberts MC. 2005. FEMS Microbiol Lett 245(2): 195-203. Update on acquired tetracycline resistance genes. (PMID 15837373)

Kyselkova M, et al. 2012. Microbes Environ 27(4): 413-422. Tetracycline Resistance and Presence of Tetracycline Resistance Determinants tet(V) and tap in Rapidly Growing Mycobacteria from Agricultural Soils and Clinical Isolates. (PMID 22673307)

Resistomes

Prevalence of tet(V) among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
No prevalence data


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 770


>gb|AAB84282.1|-|tet(V) [Mycolicibacterium smegmatis MC2 155]
MRSPRPVAGWRVLAPFRIREYRLLIAAVTLSIFAEGMWSVVMALQVIAIDNDPASLSLVATCLGVGLVAFVLVGGITADRINQRTIIIAV
EVVNFVTVAVISALALLGVLKIWHMAVAAGILGIAAAFFFPAYSAILPRILPPEQLLAANGVEGVVRPVFQRSVGPAVAGMVIGATMPSI
GAVVVAVLFALGLALLVATRPPAQPASEHHERPHVLRDLREGFAFVLKTPWLLWTVLFASMFVLVVLGPIEVLLPFIAQDRFADGARAYG
FILAFFGIGSAMGALTVSSRRMPRRYLTTMMLMWGLGSIPLVIVGYTSSFPLMAAATFVIGVTDGAGMVIWGTLLQRRVPTEMLGRVSSL
DFFVSLAFMPLSFAIVGPLSKVVSMEVIFATAGLVPVAIAAVAFTAARMHRDEVANPLL


>gb|AF030344.1|-|462-1721|tet(V) [Mycolicibacterium smegmatis MC2 155]
GTGCGCTCGCCGCGTCCGGTCGCAGGCTGGCGCGTACTCGCACCGTTCCGGATCCGCGAGTACCGCCTGCTGATCGCCGCGGTCACGCTG
TCGATCTTCGCCGAGGGCATGTGGTCTGTGGTCATGGCGCTGCAGGTGATCGCGATCGACAACGATCCGGCGTCACTGTCGCTGGTCGCG
ACGTGCCTCGGTGTCGGCCTGGTCGCGTTCGTCCTCGTCGGCGGCATCACCGCGGACCGGATCAACCAGCGCACCATCATCATTGCCGTC
GAGGTGGTCAACTTCGTCACGGTCGCGGTGATCTCCGCGCTGGCCCTGCTGGGCGTGCTGAAGATCTGGCACATGGCCGTTGCCGCAGGC
ATTCTCGGCATCGCGGCGGCGTTCTTCTTCCCGGCCTACAGCGCGATCCTGCCGCGCATCCTGCCGCCCGAACAGCTGCTGGCCGCCAAC
GGTGTCGAGGGCGTGGTACGCCCGGTGTTCCAGCGTTCGGTGGGCCCCGCGGTGGCCGGCATGGTCATCGGTGCAACGATGCCGTCGATC
GGCGCGGTCGTGGTGGCGGTGCTGTTCGCGCTCGGCCTGGCGCTGCTGGTCGCGACCCGTCCGCCCGCCCAGCCCGCCTCCGAGCACCAT
GAGCGCCCGCACGTATTGCGGGACCTGCGTGAAGGTTTCGCCTTCGTCCTGAAGACACCGTGGCTGCTGTGGACCGTGCTGTTCGCGAGC
ATGTTCGTGCTCGTCGTGCTGGGACCCATCGAGGTGCTGCTGCCGTTCATCGCACAGGACCGCTTCGCCGACGGCGCCCGCGCCTACGGT
TTCATCCTGGCGTTCTTCGGTATCGGCAGTGCGATGGGCGCGCTGACGGTGTCGTCGCGGCGCATGCCGCGCCGCTATCTCACGACCATG
ATGCTGATGTGGGGTCTCGGCTCGATTCCCCTTGTGATCGTGGGATATACATCGTCGTTCCCGCTGATGGCCGCTGCGACGTTCGTCATC
GGCGTCACCGACGGCGCTGGCATGGTGATCTGGGGAACGCTGCTGCAACGGCGTGTGCCCACCGAGATGCTGGGCCGCGTGTCGAGCCTG
GACTTCTTCGTATCGCTGGCGTTCATGCCGTTGTCATTCGCGATCGTGGGTCCGCTGTCGAAGGTGGTCTCGATGGAGGTGATCTTCGCG
ACGGCGGGTCTGGTGCCCGTGGCGATCGCGGCCGTGGCGTTCACCGCGGCGCGCATGCACCGTGACGAGGTGGCGAACCCACTGCTGTGA