CTX-M-2

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3001865
CARD Short NameCTX-M-2
DefinitionCTX-M-2 is a beta-lactamase found in the Enterobacteriaceae family.
AMR Gene FamilyCTX-M beta-lactamase
Drug Classazole antibiotic, imidazole antibiotic, cephalosporin
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEscherichia coli (38), Klebsiella pneumoniae (18), Proteus mirabilis (12), Enterobacteriaceae (8), Salmonella enterica (4), Salmonella (4), Acinetobacter baumannii (3), Klebsiella oxytoca (3), Kluyvera ascorbata (3), Enterobacter (2)
GAZBrazil (9), Japan (5), Argentina (5), Buenos Aires (2), Peru (2), Unity State (2)
FOODONpoultry drumstick (5), dairy cow (2), meat (skinless) (2), Bos taurus (2), chicken (2)
ENVOhospital (7), farm (4)
UBERONmembrane organ (3), feces (2), urine (2)
Classification14 ontology terms | Show
Parent Term(s)1 ontology terms | Show
+ CTX-M beta-lactamase [AMR Gene Family]
Resistomes with Perfect MatchesAcinetobacter baumanniiwgs, Aeromonas hydrophilawgs, Citrobacter koseriwgs, Enterobacter cloacaeg+p, Enterobacter hormaecheip+wgs, Escherichia colig+p+wgs, Klebsiella aerogeneswgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatawgs, Morganella morganiiwgs, Proteus mirabilisg+wgs+gi, Providencia rettgeriwgs, Providencia stuartiiwgs, Pseudomonas aeruginosawgs, Salmonella entericap+wgs, Serratia marcescenswgs, Vibrio choleraep+wgs
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Aeromonas hydrophilawgs, Citrobacter koseriwgs, Enterobacter cloacaeg+p, Enterobacter hormaecheip+wgs, Escherichia colig+p+wgs, Klebsiella aerogeneswgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatawgs, Morganella morganiiwgs, Proteus mirabilisg+wgs+gi, Providencia rettgeriwgs, Providencia stuartiiwgs, Pseudomonas aeruginosawgs, Salmonella entericap+wgs, Serratia marcescenswgs, Vibrio choleraep+wgs
Publications

Bauernfeind A, et al. 1996. Antimicrob Agents Chemother 40(2): 509-513. Sequences of beta-lactamase genes encoding CTX-M-1 (MEN-1) and CTX-M-2 and relationship of their amino acid sequences with those of other beta-lactamases. (PMID 8834913)

Resistomes

Prevalence of CTX-M-2 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0%0%0.04%0%0%
Aeromonas hydrophila0%0%0.81%0%0%
Citrobacter koseri0%0%3.6%0%0%
Enterobacter cloacae1.79%0.56%0%0%0%
Enterobacter hormaechei0%0.06%0.09%0%0%
Escherichia coli0.02%0.01%0.31%0%0%
Klebsiella aerogenes0%0%0.56%0%0%
Klebsiella pneumoniae0.12%0.14%0.95%0%0%
Klebsiella quasipneumoniae0%0.42%0.13%0%0%
Leclercia adecarboxylata0%0%2.33%0%0%
Morganella morganii0%0%0.61%0%0%
Proteus mirabilis0.92%0%1.16%3.7%0%
Providencia rettgeri0%0%0.64%0%0%
Providencia stuartii0%0%6.82%0%0%
Pseudomonas aeruginosa0%0%0.1%0%0%
Salmonella enterica0%0.11%0.25%0%0%
Serratia marcescens0%0%0.39%0%0%
Vibrio cholerae0%5.26%0.06%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|AAZ95872.1|+|CTX-M-2 [Escherichia coli]
MMTQSIRRSMLTVMATLPLLFSSATLHAQANSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESD
KHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDP
RDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPE
QKAESRRDILAAAAKIVTHGF


>gb|DQ125241.2|+|6833-7708|CTX-M-2 [Escherichia coli]
ATGATGACTCAGAGCATTCGCCGCTCAATGTTAACGGTGATGGCGACGCTACCCCTGCTATTTAGCAGCGCAACGCTGCATGCGCAGGCG
AACAGCGTGCAACAGCAGCTGGAAGCCCTGGAGAAAAGTTCGGGAGGTCGGCTTGGCGTTGCGCTGATTAACACCGCCGATAATTCGCAG
ATTCTCTACCGTGCCGATGAACGTTTTGCGATGTGCAGTACCAGTAAGGTGATGGCGGCCGCGGCGGTGCTTAAACAGAGCGAGAGCGAT
AAGCACCTGCTAAATCAGCGCGTTGAAATCAAGAAGAGCGACCTGGTTAACTACAATCCCATTGCGGAGAAACACGTTAACGGCACGATG
ACGCTGGCTGAGCTTGGCGCAGCGGCGCTGCAGTATAGCGACAATACTGCCATGAATAAGCTGATTGCCCATCTGGGTGGTCCCGATAAA
GTGACGGCGTTTGCTCGCTCGTTGGGTGATGAGACCTTCCGTCTGGACAGAACCGAGCCCACGCTCAATACCGCCATTCCAGGCGACCCG
CGTGATACCACCACGCCGCTCGCGATGGCGCAGACCCTGAAAAATCTGACGCTGGGTAAAGCGCTGGCGGAAACTCAGCGGGCACAGTTG
GTGACGTGGCTTAAGGGCAATACTACCGGTAGCGCGAGCATTCGGGCGGGTCTGCCGAAATCATGGGTAGTGGGCGATAAAACCGGCAGC
GGAGATTATGGCACCACCAACGATATCGCGGTTATCTGGCCGGAAAACCACGCACCGCTGGTTCTGGTGACCTACTTTACCCAACCGGAG
CAGAAGGCGGAAAGCCGTCGGGATATTCTGGCTGCGGCGGCGAAAATCGTAACCCACGGTTTCTGA

Curator Acknowledgements
Curator Description Most Recent Edit