CMY-4

Download Sequences

Accession	ARO:3002015
CARD Short Name	CMY-4
Definition	CMY-4 is a beta-lactamase found in Proteus mirabilis.
AMR Gene Family	CMY beta-lactamase
Drug Class	cephamycin
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Aeromonas caviae^wgs, Citrobacter amalonaticus^wgs, Citrobacter freundii^p+wgs, Citrobacter portucalensis^g+p, Enterobacter cloacae^wgs, Enterobacter hormaechei^wgs, Escherichia coli^p+wgs, Klebsiella michiganensis^wgs, Klebsiella pneumoniae^g+p+wgs, Klebsiella quasipneumoniae^p, Morganella morganii^wgs, Proteus mirabilis^wgs, Providencia rettgeri^wgs, Providencia stuartii^p+wgs, Salmonella enterica^g+p+wgs, Serratia marcescens^wgs, Shigella flexneri^wgs, Vibrio cholerae^wgs, Vibrio parahaemolyticus^wgs
Resistomes with Sequence Variants	Aeromonas caviae^wgs, Citrobacter amalonaticus^wgs, Citrobacter freundii^p+wgs, Citrobacter portucalensis^g+p, Enterobacter cloacae^wgs, Enterobacter hormaechei^wgs, Escherichia coli^p+wgs, Klebsiella michiganensis^wgs, Klebsiella pneumoniae^g+p+wgs, Klebsiella quasipneumoniae^p, Morganella morganii^wgs, Proteus mirabilis^wgs, Providencia rettgeri^wgs, Providencia stuartii^p+wgs, Salmonella enterica^g+p+wgs, Serratia marcescens^wgs, Shigella flexneri^wgs, Vibrio cholerae^wgs, Vibrio parahaemolyticus^wgs
Classification	16 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + hydrolysis of antibiotic conferring resistance + hydrolysis of beta-lactam antibiotic by serine beta-lactamase + beta-lactamase + antibiotic molecule + class C beta-lactamase + beta-lactam antibiotic + cephem + CMY-LAT-MOX beta-lactamase + CMY-MOX beta-lactamase + CMY-LAT beta-lactamase + cephamycin [Drug Class]
Parent Term(s)	1 ontology terms \| Show + CMY beta-lactamase [AMR Gene Family]
Publications	Verdet C, et al. 1998. FEMS Microbiol Lett 169(2): 235-240. Characterisation of CMY-4, an AmpC-type plasmid-mediated beta-lactamase in a Tunisian clinical isolate of Proteus mirabilis. (PMID 9868767)

Resistomes

Prevalence of CMY-4 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI
Aeromonas caviae	0%	0%	2.15%	0%
Aeromonas caviae	0%	0%	2.15%	0%
Citrobacter amalonaticus	0%	0%	3.64%	0%
Citrobacter amalonaticus	0%	0%	3.64%	0%
Citrobacter freundii	0%	1.23%	0.77%	0%
Citrobacter freundii	0%	1.23%	0.77%	0%
Citrobacter portucalensis	3.7%	1.47%	0%	0%
Citrobacter portucalensis	3.7%	1.47%	0%	0%
Enterobacter cloacae	0%	0%	0.64%	0%
Enterobacter cloacae	0%	0%	0.64%	0%
Enterobacter hormaechei	0%	0%	0.17%	0%
Enterobacter hormaechei	0%	0%	0.13%	0%
Escherichia coli	0%	0.06%	0.12%	0%
Escherichia coli	0%	0.06%	0.12%	0%
Klebsiella michiganensis	0%	0%	0.27%	0%
Klebsiella michiganensis	0%	0%	0.27%	0%
Klebsiella pneumoniae	0.12%	0.12%	0.24%	0%
Klebsiella pneumoniae	0.12%	0.16%	0.24%	0%
Klebsiella quasipneumoniae	0%	0.21%	0%	0%
Klebsiella quasipneumoniae	0%	0.21%	0%	0%
Morganella morganii	0%	0%	0.61%	0%
Morganella morganii	0%	0%	0.61%	0%
Proteus mirabilis	0%	0%	0.33%	0%
Proteus mirabilis	0%	0%	0.33%	0%
Providencia rettgeri	0%	0%	2.55%	0%
Providencia rettgeri	0%	0%	2.55%	0%
Providencia stuartii	0%	2.27%	2.27%	0%
Providencia stuartii	0%	2.27%	2.27%	0%
Salmonella enterica	0.06%	0.05%	0.01%	0%
Salmonella enterica	0.06%	0.05%	0.01%	0%
Serratia marcescens	0%	0%	0.26%	0%
Serratia marcescens	0%	0%	0.26%	0%
Shigella flexneri	0%	0%	0.16%	0%
Shigella flexneri	0%	0%	0.16%	0%
Vibrio cholerae	0%	0%	0.06%	0%
Vibrio cholerae	0%	0%	0.06%	0%
Vibrio parahaemolyticus	0%	0%	0.05%	0%
Vibrio parahaemolyticus	0%	0%	0.05%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 700

Protein
DNA

>gb|CAA75402.1|+|CMY-4 [Proteus mirabilis] Partial
MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFN
GVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA
LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYARGYREGKPVHVSPGQLDAEAYGVKSSVIDMARWVQANMDASHVQEKTLQQ
GIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLA
NKSYPNPVRVEAAWRILEKLQ

>gb|Y15130.1|+|1-1143|CMY-4 [Proteus mirabilis] Partial
ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACATTTGCTGCCGCAAAAACAGAACAACAGATTGCCGAT
ATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTAT
TTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGATCGGTTAGTAAGACGTTTAAC
GGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAG
TGGCAGGGTATCCGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTAGGGATAAAGCCGCA
TTACTGCATTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGACTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCG
CTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACG
GTTCCGCAGAACGAACAAAAAGATTATGCCAGGGGCTATCGCGAAGGGAAGCCCGTACACGTTTCTCCGGGACAACTTGACGCCGAAGCC
TATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATGGATGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAG
GGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCT
GATTCGATCATCAACGGCAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCC
TCATGGGTGCATAAAACGGGCTCCACTGGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCA
AACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTACAA

CMY-4

Prevalence: protein homolog model (view sequences)

Graph