CARB-4

Accession ARO:3002243
Synonym(s)BlaP3
DefinitionCARB-4 is a beta-lactamase found in Pseudomonas aeruginosa
AMR Gene FamilyCARB beta-lactamase
Drug Classpenam
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesVibrio choleraep
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Pseudomonas aeruginosap, Pseudomonas putidawgs, Pseudomonas stutzerip, Vibrio choleraep, Vibrio parahaemolyticuswgs
Classification12 ontology terms | Show
Parent Term(s)1 ontology terms | Show
+ CARB beta-lactamase [AMR Gene Family]
Publications

Sanschagrin F, et al. 1998. Antimicrob Agents Chemother 42(8): 1966-1972. Structure of CARB-4 and AER-1 carbenicillin-hydrolyzing beta-lactamases. (PMID 9687391)

Resistomes

Prevalence of CARB-4 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 263 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Acinetobacter baumannii0%0%0.26%0%
Pseudomonas aeruginosa0%1.2%0%0%
Pseudomonas putida0%0%2.59%0%
Pseudomonas stutzeri0%8.33%0%0%
Vibrio cholerae0%6.67%0%0%
Vibrio parahaemolyticus0%0%0.15%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 500


>gb|AAC09012.1|+|CARB-4 [Pseudomonas aeruginosa]
MKLLLVFSLLIPSMVFANSSKFQQVEQDAKVIEASLSAHIGISVLDTQTGEYWDYNGNQRFPLTSTFKTIACAKLLYDAEQGEINPKSTI
EIKKADLVTYSPVIEKQVGQAITLDDACFATMTTSDNAAANIILNALGGPESVTDFLRQIGDKETRLDRIEPELNEGKLGDLRDTTTPNA
IVNTLNELLFGSTLSQDGQKKLEYWMVNNQVTGNLLRSVLPEGWNIADRSGAGGFGARSITAVVWSEAQSPIIVSIYLAQTEASIADRND
AIVKIGRSIFEVYSSQSR


>gb|U14749|+|691-1557|CARB-4 [Pseudomonas aeruginosa]
ATGAAGCTTTTACTGGTATTTTCGCTTTTAATACCGTCTATGGTGTTTGCAAATAGTTCAAAGTTTCAACAGGTTGAACAAGATGCTAAG
GTAATTGAAGCATCTCTTTCTGCGCATATAGGGATTTCTGTTCTTGATACTCAAACTGGAGAGTATTGGGATTACAATGGCAATCAGCGT
TTTCCTTTGACAAGTACTTTTAAAACAATAGCTTGTGCTAAATTATTATATGATGCTGAGCAAGGGGAAATAAACCCTAAGAGTACAATT
GAGATCAAAAAAGCAGATCTTGTGACCTATTCTCCCGTAATAGAAAAGCAAGTAGGACAAGCAATAACGCTCGATGATGCGTGTTTTGCA
ACTATGACGACAAGTGATAATGCAGCAGCAAATATCATCCTAAATGCCCTAGGAGGTCCTGAAAGCGTGACGGATTTTCTAAGACAAATC
GGAGATAAAGAAACCCGTCTAGACCGTATTGAACCTGAATTAAATGAAGGCAAGCTTGGTGATTTGAGGGATACGACAACTCCTAATGCA
ATAGTGAATACTTTAAATGAATTATTATTTGGTTCCACATTGTCTCAAGATGGCCAGAAAAAATTAGAGTATTGGATGGTGAATAATCAA
GTCACTGGTAATTTATTGCGGTCAGTATTGCCAGAGGGATGGAATATTGCGGATCGTTCAGGTGCTGGCGGATTTGGTGCTCGGAGTATT
ACAGCCGTTGTTTGGAGTGAAGCTCAATCCCCAATCATAGTTAGTATCTATCTAGCGCAAACAGAGGCTTCAATAGCAGATCGAAATGAT
GCAATTGTTAAAATTGGTCGTTCAATTTTTGAAGTTTATTCATCACAATCGCGTTGA