ANT(6)-Ia

Download Sequences

Accession	ARO:3002626
Synonym(s)	ant6, aadE
CARD Short Name	ANT(6)-Ia
Definition	ANT(6)-Ia is an aminoglycoside nucleotidyltransferase gene encoded by plasmids and chromosomes in Staphylococcus epidermidis, E. faecium, Streptococcus suis, S. aureus, E. faecalis and Streptococcus mitis.
AMR Gene Family	ANT(6)
Drug Class	aminoglycoside antibiotic
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Clostridium perfringens^wgs, Enterococcus avium^wgs, Enterococcus faecalis^g+p+wgs, Enterococcus faecium^g+p+wgs+gi, Enterococcus hirae^g+p+wgs+gi, Erysipelothrix rhusiopathiae^g+gi, Herbinix luporum^g+gi, Jeotgalibaca arthritidis^g, Klebsiella quasipneumoniae^wgs, Lactococcus garvieae^p+wgs, Ligilactobacillus animalis^wgs, Listeria innocua^p+wgs, Macrococcus canis^g, Staphylococcus aureus^g+p+wgs+gi, Staphylococcus epidermidis^wgs, Staphylococcus saprophyticus^p+wgs, Streptococcus agalactiae^g+wgs, Streptococcus dysgalactiae^g+wgs, Streptococcus gallolyticus^g+wgs, Streptococcus lutetiensis^wgs, Streptococcus pasteurianus^g+wgs, Streptococcus pyogenes^wgs, Streptococcus suis^g+wgs+gi, Streptococcus uberis^wgs
Resistomes with Sequence Variants	Campylobacter jejuni^gi, Clostridium perfringens^wgs, Enterococcus avium^wgs, Enterococcus faecalis^g+p+wgs+gi, Enterococcus faecium^g+p+wgs+gi, Enterococcus hirae^g+p+wgs+gi, Erysipelothrix rhusiopathiae^g+gi, Herbinix luporum^g+gi, Jeotgalibaca arthritidis^g, Klebsiella quasipneumoniae^wgs, Lactococcus garvieae^p+wgs, Ligilactobacillus animalis^wgs, Listeria innocua^p+wgs, Macrococcus canis^g, Staphylococcus aureus^g+p+wgs+gi, Staphylococcus epidermidis^wgs, Staphylococcus pseudintermedius^wgs, Staphylococcus saprophyticus^p+wgs, Streptococcus agalactiae^g+wgs, Streptococcus dysgalactiae^g+wgs, Streptococcus gallolyticus^g+wgs, Streptococcus lutetiensis^wgs, Streptococcus pasteurianus^g+wgs, Streptococcus pyogenes^wgs, Streptococcus suis^g+wgs+gi, Streptococcus uberis^wgs
Classification	11 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + aminoglycoside modifying enzyme + nucleotidylation of antibiotic conferring resistance + antibiotic molecule + aminoglycoside nucleotidyltransferase (ANT) + aminoglycoside antibiotic [Drug Class] + ANT(6) [AMR Gene Family]
Parent Term(s)	2 ontology terms \| Show + confers_resistance_to_antibiotic streptomycin [Antibiotic] + ANT(6)-I
Publications	Pinto-Alphandary H, et al. 1990. Antimicrob Agents Chemother 34(6): 1294-1296. Emergence of aminoglycoside resistance genes aadA and aadE in the genus Campylobacter. (PMID 2168151) Gill SR, et al. 2005. J Bacteriol 187(7): 2426-2438. Insights on evolution of virulence and resistance from the complete genome analysis of an early methicillin-resistant Staphylococcus aureus strain and a biofilm-producing methicillin-resistant Staphylococcus epidermidis strain. (PMID 15774886) Holden MT, et al. 2009. PLoS One 4(7): E6072. Rapid evolution of virulence and drug resistance in the emerging zoonotic pathogen Streptococcus suis. (PMID 19603075)

Resistomes

Prevalence of ANT(6)-Ia among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Campylobacter jejuni	0%	0%	0%	15.38%	0%
Campylobacter jejuni	0%	0%	0%	0%	0%
Clostridium perfringens	0%	0%	1.22%	0%	0%
Clostridium perfringens	0%	0%	1.22%	0%	0%
Enterococcus avium	0%	0%	1.75%	0%	0%
Enterococcus avium	0%	0%	1.75%	0%	0%
Enterococcus faecalis	4.55%	1.23%	2.3%	4.17%	0%
Enterococcus faecalis	4.55%	1.23%	2.05%	0%	0%
Enterococcus faecium	0.32%	1.68%	6.41%	1.96%	0%
Enterococcus faecium	0.32%	1.68%	6.52%	1.96%	0%
Enterococcus hirae	15.38%	4.76%	6.94%	100%	0%
Enterococcus hirae	15.38%	4.76%	5.56%	100%	0%
Erysipelothrix rhusiopathiae	27.27%	0%	0%	66.67%	0%
Erysipelothrix rhusiopathiae	27.27%	0%	0%	66.67%	0%
Escherichia coli	0%	0%	0%	0%	0%
Escherichia coli	0%	0%	0%	0%	0%
Herbinix luporum	100%	0%	0%	100%	0%
Herbinix luporum	100%	0%	0%	100%	0%
Jeotgalibaca arthritidis	100%	0%	0%	0%	0%
Jeotgalibaca arthritidis	100%	0%	0%	0%	0%
Klebsiella quasipneumoniae	0%	0%	0.13%	0%	0%
Klebsiella quasipneumoniae	0%	0%	0.13%	0%	0%
Lactococcus garvieae	0%	4.17%	2.22%	0%	0%
Lactococcus garvieae	0%	4.17%	2.22%	0%	0%
Ligilactobacillus animalis	0%	0%	33.33%	0%	0%
Ligilactobacillus animalis	0%	0%	33.33%	0%	0%
Listeria innocua	0%	15.79%	2.26%	0%	0%
Listeria innocua	0%	15.79%	2.26%	0%	0%
Macrococcus canis	7.14%	0%	0%	0%	0%
Macrococcus canis	7.14%	0%	0%	0%	0%
Staphylococcus aureus	1.83%	0.04%	2.41%	1.15%	0%
Staphylococcus aureus	1.83%	0.04%	2.45%	1.15%	0%
Staphylococcus epidermidis	0%	0%	0.08%	0%	0%
Staphylococcus epidermidis	0%	0%	0.08%	0%	0%
Staphylococcus pseudintermedius	0%	0%	0.77%	0%	0%
Staphylococcus pseudintermedius	0%	0%	0%	0%	0%
Staphylococcus saprophyticus	0%	2.7%	1.4%	0%	0%
Staphylococcus saprophyticus	0%	2.7%	1.4%	0%	0%
Streptococcus agalactiae	4.67%	0%	1.74%	0%	0%
Streptococcus agalactiae	5.61%	0%	2.26%	0%	0%
Streptococcus dysgalactiae	2%	0%	4.67%	0%	0%
Streptococcus dysgalactiae	2%	0%	4.67%	0%	0%
Streptococcus gallolyticus	10%	0%	9.09%	0%	0%
Streptococcus gallolyticus	10%	0%	9.09%	0%	0%
Streptococcus lutetiensis	0%	0%	2.04%	0%	0%
Streptococcus lutetiensis	0%	0%	2.04%	0%	0%
Streptococcus pasteurianus	50%	0%	20%	0%	0%
Streptococcus pasteurianus	50%	0%	20%	0%	0%
Streptococcus pyogenes	0%	0%	0.05%	0%	0%
Streptococcus pyogenes	0%	0%	0.05%	0%	0%
Streptococcus suis	17.6%	0%	30.9%	33.33%	0%
Streptococcus suis	16.8%	0%	28.75%	33.33%	0%
Streptococcus uberis	0%	0%	6.25%	0%	0%
Streptococcus uberis	0%	0%	6.25%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500

Protein
DNA

>gb|AHE40557.1|-|ANT(6)-Ia [Exiguobacterium sp. S3-2]
MRSEKEMMDLVLSLAEQDERIRIVTLEGSRANINIPKDEFQDYDITYFVSDIEPFISNDDWLNQFGNIIMMQKPEDMELFPPEEKGFSYL
MLFDDYNKIDLTLLPLEELDNYLKGDKLIKVLIDKDCRIKRDIVPTDIDYHVRKPSAREYDDCCNEFWNVTPYVIKGLCRKEILFAIDHL
NQILRFELLRMMSWKVGIKTEFSLSVGKNYKYINKYIDEDLWNRLLSTYRMDSYENIWKSLFICHQLFREVSKEVAELLGFDYPEYGKNI
TRYTEDMYKKYVENDYF

>gb|KF648874.1|-|60997-61860|ANT(6)-Ia [Exiguobacterium sp. S3-2]
ATGAGATCAGAAAAAGAAATGATGGATTTAGTACTTTCTTTAGCAGAACAGGATGAACGTATTCGAATTGTGACCCTTGAGGGGTCACGC
GCAAATATTAATATACCTAAAGATGAATTTCAGGATTATGATATTACATATTTTGTAAGTGATATAGAACCGTTTATATCTAATGATGAC
TGGCTTAATCAATTTGGGAATATAATAATGATGCAAAAGCCGGAGGATATGGAATTATTCCCACCTGAAGAAAAGGGATTTTCCTATCTT
ATGCTATTTGATGATTACAATAAAATTGATCTTACCTTATTGCCCTTGGAAGAGTTAGATAATTACCTAAAGGGCGATAAATTAATAAAG
GTTCTAATTGATAAAGATTGTAGAATTAAAAGGGACATAGTTCCGACTGATATAGATTATCATGTAAGAAAGCCAAGCGCAAGGGAGTAT
GATGATTGCTGCAATGAATTTTGGAATGTAACACCTTATGTTATTAAAGGATTGTGCCGCAAAGAGATACTGTTTGCAATCGATCATCTG
AACCAGATTCTACGGTTTGAACTACTTAGGATGATGTCGTGGAAGGTTGGGATAAAGACAGAATTTTCATTAAGTGTTGGGAAAAATTAT
AAGTATATTAACAAATACATTGATGAAGATCTATGGAATAGATTATTATCTACATATCGCATGGATTCCTATGAAAATATTTGGAAGTCA
TTATTTATATGCCACCAATTGTTCAGGGAAGTGTCCAAAGAGGTAGCAGAACTACTGGGGTTTGATTATCCAGAGTATGGTAAGAACATA
ACAAGATATACCGAGGACATGTATAAAAAATATGTTGAAAATGACTATTTTTAA

Curator Acknowledgements

Curator	Description	Most Recent Edit

ANT(6)-Ia

Prevalence: protein homolog model (view sequences)

Graph