ANT(6)-Ia

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002626
Synonym(s)ant6, aadE
CARD Short NameANT(6)-Ia
DefinitionANT(6)-Ia is an aminoglycoside nucleotidyltransferase gene encoded by plasmids and chromosomes in Staphylococcus epidermidis, E. faecium, Streptococcus suis, S. aureus, E. faecalis and Streptococcus mitis.
AMR Gene FamilyANT(6)
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEnterococcus faecium (8), Enterococcus faecalis (6), Enterococcus (2)
GAZ
FOODON
ENVO
UBERON
Classification11 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic streptomycin [Antibiotic]
+ ANT(6)-I
Resistomes with Perfect MatchesClostridium perfringenswgs, Enterococcus aviumwgs, Enterococcus faecalisg+p+wgs, Enterococcus faeciumg+p+wgs+gi, Enterococcus hiraeg+p+wgs+gi, Erysipelothrix rhusiopathiaeg+gi, Herbinix luporumg+gi, Jeotgalibaca arthritidisg, Klebsiella quasipneumoniaewgs, Lactococcus garvieaep+wgs, Ligilactobacillus animaliswgs, Listeria innocuap+wgs, Macrococcoides canisg, Staphylococcus aureusg+p+wgs+gi, Staphylococcus epidermidiswgs, Staphylococcus saprophyticusp+wgs, Streptococcus agalactiaeg+wgs, Streptococcus dysgalactiaeg+wgs, Streptococcus gallolyticusg+wgs, Streptococcus lutetiensiswgs, Streptococcus pasteurianusg+wgs, Streptococcus pyogeneswgs, Streptococcus suisg+wgs+gi, Streptococcus uberiswgs
Resistomes with Sequence VariantsCampylobacter jejunigi, Clostridium perfringenswgs, Enterococcus aviumwgs, Enterococcus faecalisg+p+wgs+gi, Enterococcus faeciumg+p+wgs+gi, Enterococcus hiraeg+p+wgs+gi, Erysipelothrix rhusiopathiaeg+gi, Herbinix luporumg+gi, Jeotgalibaca arthritidisg, Klebsiella quasipneumoniaewgs, Lactococcus garvieaep+wgs, Ligilactobacillus animaliswgs, Listeria innocuap+wgs, Macrococcoides canisg, Staphylococcus aureusg+p+wgs+gi, Staphylococcus epidermidiswgs, Staphylococcus pseudintermediuswgs, Staphylococcus saprophyticusp+wgs, Streptococcus agalactiaeg+wgs, Streptococcus dysgalactiaeg+wgs, Streptococcus gallolyticusg+wgs, Streptococcus lutetiensiswgs, Streptococcus pasteurianusg+wgs, Streptococcus pyogeneswgs, Streptococcus suisg+wgs+gi, Streptococcus uberiswgs
Publications

Pinto-Alphandary H, et al. 1990. Antimicrob Agents Chemother 34(6): 1294-1296. Emergence of aminoglycoside resistance genes aadA and aadE in the genus Campylobacter. (PMID 2168151)

Gill SR, et al. 2005. J Bacteriol 187(7): 2426-2438. Insights on evolution of virulence and resistance from the complete genome analysis of an early methicillin-resistant Staphylococcus aureus strain and a biofilm-producing methicillin-resistant Staphylococcus epidermidis strain. (PMID 15774886)

Holden MT, et al. 2009. PLoS One 4(7): E6072. Rapid evolution of virulence and drug resistance in the emerging zoonotic pathogen Streptococcus suis. (PMID 19603075)

Resistomes

Prevalence of ANT(6)-Ia among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Campylobacter jejuni0%0%0%15.38%0%
Clostridium perfringens0%0%1.22%0%0%
Enterococcus avium0%0%1.75%0%0%
Enterococcus faecalis4.55%1.23%2.3%4.17%0%
Enterococcus faecium0.32%1.68%6.52%1.96%0%
Enterococcus hirae15.38%4.76%6.94%100%0%
Erysipelothrix rhusiopathiae27.27%0%0%66.67%0%
Escherichia coli0%0%0%0%0%
Herbinix luporum100%0%0%100%0%
Jeotgalibaca arthritidis100%0%0%0%0%
Klebsiella quasipneumoniae0%0%0.13%0%0%
Lactococcus garvieae0%4.17%2.22%0%0%
Ligilactobacillus animalis0%0%33.33%0%0%
Listeria innocua0%15.79%2.26%0%0%
Macrococcoides canis7.14%0%0%0%0%
Staphylococcus aureus1.83%0.04%2.45%1.15%0%
Staphylococcus epidermidis0%0%0.08%0%0%
Staphylococcus pseudintermedius0%0%0.77%0%0%
Staphylococcus saprophyticus0%2.7%1.4%0%0%
Streptococcus agalactiae5.61%0%2.26%0%0%
Streptococcus dysgalactiae2%0%4.67%0%0%
Streptococcus gallolyticus10%0%9.09%0%0%
Streptococcus lutetiensis0%0%2.04%0%0%
Streptococcus pasteurianus50%0%20%0%0%
Streptococcus pyogenes0%0%0.05%0%0%
Streptococcus suis17.6%0%30.9%33.33%0%
Streptococcus uberis0%0%6.25%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|AHE40557.1|-|ANT(6)-Ia [Exiguobacterium sp. S3-2]
MRSEKEMMDLVLSLAEQDERIRIVTLEGSRANINIPKDEFQDYDITYFVSDIEPFISNDDWLNQFGNIIMMQKPEDMELFPPEEKGFSYL
MLFDDYNKIDLTLLPLEELDNYLKGDKLIKVLIDKDCRIKRDIVPTDIDYHVRKPSAREYDDCCNEFWNVTPYVIKGLCRKEILFAIDHL
NQILRFELLRMMSWKVGIKTEFSLSVGKNYKYINKYIDEDLWNRLLSTYRMDSYENIWKSLFICHQLFREVSKEVAELLGFDYPEYGKNI
TRYTEDMYKKYVENDYF


>gb|KF648874.1|-|60997-61860|ANT(6)-Ia [Exiguobacterium sp. S3-2]
ATGAGATCAGAAAAAGAAATGATGGATTTAGTACTTTCTTTAGCAGAACAGGATGAACGTATTCGAATTGTGACCCTTGAGGGGTCACGC
GCAAATATTAATATACCTAAAGATGAATTTCAGGATTATGATATTACATATTTTGTAAGTGATATAGAACCGTTTATATCTAATGATGAC
TGGCTTAATCAATTTGGGAATATAATAATGATGCAAAAGCCGGAGGATATGGAATTATTCCCACCTGAAGAAAAGGGATTTTCCTATCTT
ATGCTATTTGATGATTACAATAAAATTGATCTTACCTTATTGCCCTTGGAAGAGTTAGATAATTACCTAAAGGGCGATAAATTAATAAAG
GTTCTAATTGATAAAGATTGTAGAATTAAAAGGGACATAGTTCCGACTGATATAGATTATCATGTAAGAAAGCCAAGCGCAAGGGAGTAT
GATGATTGCTGCAATGAATTTTGGAATGTAACACCTTATGTTATTAAAGGATTGTGCCGCAAAGAGATACTGTTTGCAATCGATCATCTG
AACCAGATTCTACGGTTTGAACTACTTAGGATGATGTCGTGGAAGGTTGGGATAAAGACAGAATTTTCATTAAGTGTTGGGAAAAATTAT
AAGTATATTAACAAATACATTGATGAAGATCTATGGAATAGATTATTATCTACATATCGCATGGATTCCTATGAAAATATTTGGAAGTCA
TTATTTATATGCCACCAATTGTTCAGGGAAGTGTCCAAAGAGGTAGCAGAACTACTGGGGTTTGATTATCCAGAGTATGGTAAGAACATA
ACAAGATATACCGAGGACATGTATAAAAAATATGTTGAAAATGACTATTTTTAA

Curator Acknowledgements
Curator Description Most Recent Edit