aad(6)

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002628
Synonym(s)aac(6)
CARD Short Nameaad(6)
DefinitionANT(6)-Ia/aad(6) is a plasmid-encoded aminoglycoside nucleotidyltransferase gene in E. faecalis and Streptococcus oralis.
AMR Gene FamilyANT(6)
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Classification11 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic streptomycin [Antibiotic]
+ ANT(6)-I
Resistomes with Sequence VariantsAliarcobacter butzlerig+p+wgs, Anaerostipes hadruswgs, Bacteroides fragiliswgs, Bacteroides thetaiotaomicronwgs, Bifidobacterium breveg+wgs, Bifidobacterium longumg+wgs, Campylobacter colig+wgs, Campylobacter jejuniwgs, Clostridioides difficilegi, Enterocloster clostridioformiswgs, Enterococcus aviumwgs, Enterococcus faecalisg+p+wgs+gi, Enterococcus faeciumg+p+wgs+gi, Enterococcus hiraep+wgs, Erysipelothrix rhusiopathiaeg+gi, Eubacterium limosumwgs, Fusobacterium necrophorumwgs, Lachnospiraceae bacteriumgi, Listeria monocytogeneswgs, Neisseria brasiliensisg+gi, Parabacteroides distasoniswgs, Phocaeicola vulgatuswgs, Roseburia hominisgi, Staphylococcus aureusg+p+wgs+gi, Staphylococcus epidermidisp+wgs, Staphylococcus haemolyticuswgs+gi, Staphylococcus hominiswgs, Staphylococcus pseudintermediusg+wgs+gi, Staphylococcus saprophyticuswgs, Staphylococcus warneriwgs, Streptococcus agalactiaeg+wgs+gi, Streptococcus anginosuswgs, Streptococcus dysgalactiaewgs, Streptococcus equiwgs, Streptococcus gallolyticuswgs, Streptococcus mitisg, Streptococcus mutanswgs, Streptococcus pasteurianusg+wgs+gi, Streptococcus pyogenesg+wgs+gi, Streptococcus suisg+wgs
Publications

Cerda P, et al. 2007. Int Microbiol 10(1): 57-60. Detection of the aminoglycosidestreptothricin resistance gene cluster ant(6)-sat4-aph(3 ')-III in commensal viridans group streptococci. (PMID 17407061)

Schwarz FV, et al. 2001. Plasmid 46(3): 170-187. Sequence of the 50-kb conjugative multiresistance plasmid pRE25 from Enterococcus faecalis RE25. (PMID 11735367)

Resistomes

Prevalence of aad(6) among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Aliarcobacter butzleri12.5%33.33%0.81%0%0%
Anaerostipes hadrus0%0%1.72%0%0%
Bacteroides fragilis0%0%0.27%0%0%
Bacteroides thetaiotaomicron0%0%2.8%0%0%
Bifidobacterium breve5.88%0%1.81%0%0%
Bifidobacterium longum6.32%0%0.21%0%0%
Campylobacter coli1.45%0%2.2%0%0%
Campylobacter jejuni0%0%0.23%0%0%
Clostridioides difficile0%0%0%8.33%0%
Enterocloster clostridioformis0%0%11.63%0%0%
Enterococcus avium0%0%3.51%0%0%
Enterococcus faecalis1.82%9.11%13.83%4.17%0%
Enterococcus faecium2.55%10.1%33.83%3.92%0%
Enterococcus hirae0%7.14%4.17%0%0%
Erysipelothrix rhusiopathiae27.27%0%0%66.67%0%
Eubacterium limosum0%0%25%0%0%
Fusobacterium necrophorum0%0%6.98%0%0%
Lachnospiraceae bacterium0%0%0%33.33%0%
Listeria monocytogenes0%0%0.02%0%0%
Neisseria brasiliensis100%0%0%50%0%
Parabacteroides distasonis0%0%0.93%0%0%
Phocaeicola vulgatus0%0%1.11%0%0%
Roseburia hominis0%0%0%100%0%
Staphylococcus aureus4.89%0.11%3.98%4.87%0%
Staphylococcus epidermidis0%0.58%0.59%0%0%
Staphylococcus haemolyticus0%0%0.22%20%0%
Staphylococcus hominis0%0%1.46%0%0%
Staphylococcus pseudintermedius43.33%0%67.69%6.67%0%
Staphylococcus saprophyticus0%0%0.7%0%0%
Staphylococcus warneri0%0%5.74%0%0%
Streptococcus agalactiae7.48%0%6.57%33.33%0%
Streptococcus anginosus0%0%1.17%0%0%
Streptococcus dysgalactiae0%0%1.87%0%0%
Streptococcus equi0%0%0.23%0%0%
Streptococcus gallolyticus0%0%9.09%0%0%
Streptococcus mitis11.11%0%0%0%0%
Streptococcus mutans0%0%0.39%0%0%
Streptococcus pasteurianus25%0%10%16.67%0%
Streptococcus pyogenes1.12%0%0.31%18.18%0%
Streptococcus suis7.2%0%5.72%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|AAU10334.1|+|aad(6) [Streptococcus oralis] Partial
EGSRANINIPKDEFQDYDITYFVSDIEPFISNDDWLNQFGNIIMMQKPEDMELFPPEEKGFSYLMLFDDYNKIDLTLLPLEELDNYLKGD
KLIKVLIDKDCRIKRDIVPTDIDYHVRKPSAREYDDCCNEFWNVTPYVIKGLCRKEILFAIDHFNQIVRHELLRMISWKVGIETGFKLSV
GKNYKFIERYISEDLWEKLLSTYRMDSYENIWEALFLCHQLFRAVSGEVAERLHYAYPEYDRNITKYTRDMYKKYTGKTGCLDSTYAADI
EERREQ


>gb|AY712687.1|+|1-831|aad(6) [Streptococcus oralis] Partial
GAGGGGTCACGCGCAAATATTAATATACCTAAAGATGAATTTCAGGATTATGATATTACATATTTTGTAAGTGATATAGAACCGTTTATA
TCTAATGATGACTGGCTTAATCAATTTGGGAATATAATAATGATGCAAAAGCCGGAGGATATGGAATTATTCCCACCTGAAGAAAAGGGA
TTTTCCTATCTTATGCTATTTGATGATTACAATAAAATTGATCTTACCTTATTGCCCTTGGAAGAGTTAGATAATTACCTAAAGGGCGAT
AAATTAATAAAGGTTCTAATTGATAAAGATTGTAGAATTAAAAGGGACATAGTTCCGACTGATATAGATTATCATGTAAGAAAGCCAAGC
GCAAGGGAGTATGATGATTGCTGCAATGAATTTTGGAATGTAACACCTTATGTTATTAAAGGATTGTGCCGTAAGGAAATTTTATTTGCT
ATTGATCATTTTAATCAGATTGTTCGCCATGAGCTGCTGAGAATGATATCATGGAAGGTCGGCATCGAAACAGGCTTTAAATTAAGTGTA
GGCAAGAACTATAAGTTTATTGAAAGGTATATATCCGAGGATTTGTGGGAGAAACTTTTGTCCACCTACCGGATGGATTCCTATGAAAAC
ATATGGGAAGCATTATTTCTATGCCATCAATTGTTCAGGGCGGTATCCGGTGAGGTGGCGGAAAGGCTTCATTATGCCTATCCGGAGTAT
GATAGGAATATAACAAAATATACCAGGGACATGTATAAAAAATACACTGGTAAAACCGGCTGCCTGGATAGCACATATGCCGCTGATATA
GAAGAGAGGCGGGAACAGTGA

Curator Acknowledgements
Curator Description Most Recent Edit