ANT(9)-Ia

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002630
Synonym(s)aad(9) aad9 spc spw
CARD Short NameANT(9)-Ia
DefinitionANT(9)-Ia is an aminoglycoside nucleotidyltransferase encoded by plasmids and transposons in S. aureus, Enterococcus spp., Mammaliicoccus sciuri, and E. faecalis.
AMR Gene FamilyANT(9)
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONStaphylococcus aureus (3), Campylobacter coli (2)
GAZ
FOODON
ENVO
UBERON
Classification11 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic spectinomycin [Antibiotic]
+ ANT(9)-I
Resistomes with Perfect MatchesBacillus subtilisg, Bacillus thuringiensiswgs, Bacillus velezensisg, Enterococcus aviumg+wgs, Enterococcus faecalisg+p+wgs, Enterococcus faeciumg+p+wgs, Enterococcus hiraeg+wgs, Leptospira interroganswgs, Staphylococcus aureusg+p+wgs, Staphylococcus capitisg+wgs, Staphylococcus epidermidisg+wgs, Staphylococcus haemolyticusg+wgs, Staphylococcus hominiswgs, Staphylococcus lugdunensisg+wgs, Staphylococcus simulansg+wgs, Streptococcus gallolyticuswgs, Streptococcus suiswgs
Resistomes with Sequence VariantsBacillus subtilisg, Bacillus thuringiensiswgs, Bacillus velezensisg, Enterococcus aviumg+wgs, Enterococcus faecalisg+p+wgs, Enterococcus faeciumg+p+wgs, Enterococcus hiraeg+wgs, Leptospira interroganswgs, Staphylococcus aureusg+p+wgs, Staphylococcus capitisg+wgs, Staphylococcus epidermidisg+wgs, Staphylococcus haemolyticusg+wgs, Staphylococcus hominiswgs, Staphylococcus lugdunensisg+wgs, Staphylococcus pseudintermediusg, Staphylococcus simulansg+wgs, Streptococcus gallolyticuswgs, Streptococcus suiswgs
Publications

Murphy E, et al. 1985. EMBO J 4(12): 3357-3365. Transposon Tn554: complete nucleotide sequence and isolation of transposition-defective and antibiotic-sensitive mutants. (PMID 3004956)

Murphy E. 1985. Mol Gen Genet 200(1): 33-39. Nucleotide sequence of a spectinomycin adenyltransferase AAD(9) determinant from Staphylococcus aureus and its relationship to AAD(3) (9). (PMID 2993813)

Wendlandt S, et al. 2013. J Antimicrob Chemother 68(7): 1679-1680. Identification of the novel spectinomycin resistance gene spw in methicillin-resistant and methicillin-susceptible Staphylococcus aureus of human and animal origin. (PMID 23511231)

Resistomes

Prevalence of ANT(9)-Ia among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Bacillus subtilis2.15%0%0%0%0%
Bacillus thuringiensis0%0%0.17%0%0%
Bacillus velezensis0.33%0%0%0%0%
Enterococcus avium33.33%0%17.54%0%0%
Enterococcus faecalis8.18%1.48%5.42%0%0%
Enterococcus faecium3.18%0.45%6.21%0%0%
Enterococcus hirae11.54%0%2.78%0%0%
Leptospira interrogans0%0%0.32%0%0%
Staphylococcus aureus17.1%0.26%35.57%0%0%
Staphylococcus capitis30%0%26.58%0%0%
Staphylococcus epidermidis6.45%0%2.59%0%0%
Staphylococcus haemolyticus3.45%0%2.2%0%0%
Staphylococcus hominis0%0%0.98%0%0%
Staphylococcus lugdunensis5.56%0%1.54%0%0%
Staphylococcus pseudintermedius3.33%0%0%0%0%
Staphylococcus simulans5%0%6.78%0%0%
Streptococcus gallolyticus0%0%2.27%0%0%
Streptococcus suis0%0%0.16%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 450


>gb|CAA26428.1|+|ANT(9)-Ia [Staphylococcus aureus]
MSNLINGKIPNQAIQTLKIVKDLFGSSIVGVYLFGSAVNGGLRINSDVDVLVVVNHSLPQLTRKKLTERLMTISGKIGNTDSVRPLEVTV
INRSEVVPWQYPPKREFIYGEWLRGEFENGQIQEPSYDPDLAIVLAQARKNSISLFGPDSSSILVSVPLTDIRRAIKDSLPELIEGIKGD
ERNVILTLARMWQTVTTGEITSKDVAAEWAIPLLPKEHVTLLDIARKGYRGECDDKWEGLYSKVKALVKYMKNSIETSLN


>gb|X02588.1|+|331-1113|ANT(9)-Ia [Staphylococcus aureus]
ATGAGCAATTTGATTAACGGAAAAATACCAAATCAAGCGATTCAAACATTAAAAATCGTAAAAGATTTATTTGGAAGTTCAATAGTTGGA
GTATATCTATTTGGTTCAGCAGTAAATGGTGGTTTACGCATTAACAGCGATGTAGATGTTCTAGTCGTCGTGAATCATAGTTTACCTCAA
TTAACTCGAAAAAAACTAACAGAAAGACTAATGACTATATCAGGAAAGATTGGAAATACGGATTCTGTTAGACCACTTGAAGTTACGGTT
ATAAATAGGAGTGAAGTTGTCCCTTGGCAATATCCTCCAAAAAGAGAATTTATATACGGTGAGTGGCTCAGGGGTGAATTTGAGAATGGA
CAAATTCAGGAACCAAGCTATGATCCTGATTTGGCTATTGTTTTAGCACAAGCAAGAAAGAATAGTATTTCTCTATTTGGTCCTGATTCT
TCAAGTATACTTGTCTCCGTACCTTTGACAGATATTCGAAGAGCAATTAAGGATTCTTTGCCAGAACTAATTGAGGGGATAAAAGGTGAT
GAGCGTAATGTAATTTTAACCCTAGCTCGAATGTGGCAAACAGTGACTACTGGTGAAATTACCTCGAAAGATGTCGCTGCAGAATGGGCT
ATACCTCTTTTACCTAAAGAGCATGTAACTTTACTGGATATAGCTAGAAAAGGCTATCGGGGAGAGTGTGATGATAAGTGGGAAGGACTA
TATTCAAAGGTGAAAGCACTCGTTAAGTATATGAAAAATTCTATAGAAACTTCTCTCAATTAG

Curator Acknowledgements
Curator Description Most Recent Edit