APH(6)-Ic

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002659
Synonym(s)sph str
CARD Short NameAPH(6)-Ic
DefinitionAPH(6)-Ic is a transposon-encoded aminoglycoside phosphotransferase in S. enterica, P. aeruginosa and E. coli.
AMR Gene FamilyAPH(6)
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Classification11 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic streptomycin [Antibiotic]
+ APH(6)-I
Resistomes with Perfect MatchesAcinetobacter lwoffiiwgs, Burkholderia multivoranswgs, Enterobacter hormaecheiwgs, Escherichia coliwgs, Klebsiella pneumoniaewgs, Pseudomonas aeruginosag+wgs, Pseudomonas putidawgs, Salmonella entericap+wgs, Shigella sonneiwgs
Resistomes with Sequence VariantsAcinetobacter lwoffiiwgs, Aeromonas caviaewgs, Burkholderia multivoranswgs, Enterobacter hormaecheiwgs, Escherichia coliwgs, Klebsiella pneumoniaewgs, Pseudomonas aeruginosag+wgs, Pseudomonas putidawgs, Salmonella entericap+wgs, Shigella sonneiwgs
Publications

Mazodier P, et al. 1985. Nucleic Acids Res 13(1): 195-205. Completion of the nucleotide sequence of the central region of Tn5 confirms the presence of three resistance genes. (PMID 3889831)

Steiniger-White M, et al. 2004. Curr Opin Struct Biol 14(1): 50-57. Structure/function insights into Tn5 transposition. (PMID 15102449)

Resistomes

Prevalence of APH(6)-Ic among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter lwoffii0%0%2.63%0%0%
Aeromonas caviae0%0%0.54%0%0%
Burkholderia multivorans0%0%0.24%0%0%
Enterobacter hormaechei0%0%0.04%0%0%
Escherichia coli0%0%0.3%0%1.11%
Klebsiella pneumoniae0%0%0.03%0%0%
Pseudomonas aeruginosa0.31%0%0.58%0%0%
Pseudomonas putida0%0%0.53%0%0%
Salmonella enterica0%0.33%0.54%0%0%
Shigella sonnei0%0%0.15%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|CAA25854.1|+|APH(6)-Ic [Escherichia coli]
MERWRLLRDGELLTTHSSWILPVRQGDMPAMLKVARIPDEEAGYRLLTWWDGQGAARVFASAAGALLMERASGAGDLAQIAWSGQDDEAC
RILCDTAARLHAPRSGPPPDLHPLQEWFQPLFRLAAEHAALAPAASVARQLLAAPREVCPLHGDLHHENVLDFGDRGWLAIDPHGLLGER
TFDYANIFTNPDLSDPGRPLAILPGRLEARLSIVVATTGFEPERLLRWIIAWTGLSAAWFIGDGDGEGEGAAIDLAVNAMARRLLD


>gb|X01702.1|+|485-1285|APH(6)-Ic [Escherichia coli]
ATGGAGCGCTGGCGCCTGCTGCGCGACGGCGAGCTGCTCACCACCCACTCGAGCTGGATACTTCCCGTCCGCCAGGGGGACATGCCGGCG
ATGCTGAAGGTCGCGCGCATTCCCGATGAAGAGGCCGGTTACCGCCTGTTGACCTGGTGGGACGGGCAGGGCGCCGCCCGAGTCTTCGCC
TCGGCGGCGGGCGCTCTGCTCATGGAGCGCGCGTCCGGGGCCGGGGACCTTGCACAGATAGCGTGGTCCGGCCAGGACGACGAGGCTTGC
AGGATCCTCTGCGACACCGCCGCTCGTCTGCACGCGCCGCGGTCCGGACCGCCGCCCGATCTCCATCCGCTACAGGAATGGTTCCAGCCG
CTTTTCCGGTTGGCCGCTGAGCACGCGGCACTTGCGCCCGCCGCCAGCGTAGCGCGCCAACTTCTGGCGGCGCCGCGCGAGGTGTGCCCG
CTCCACGGCGACCTGCACCACGAGAACGTGCTCGACTTCGGCGACCGCGGCTGGCTGGCCATCGACCCGCACGGACTGCTCGGCGAGCGC
ACCTTCGACTATGCCAACATCTTCACGAATCCCGATCTCAGCGACCCCGGTCGCCCGCTTGCGATCCTGCCGGGCAGGCTGGAGGCTCGA
CTCAGCATTGTGGTCGCGACGACCGGGTTTGAGCCCGAACGGCTTCTTCGCTGGATCATTGCATGGACGGGCTTGTCGGCAGCCTGGTTC
ATCGGCGACGGCGACGGCGAGGGCGAGGGCGCTGCGATTGATCTGGCCGTAAACGCCATGGCACGCCGGTTGCTTGACTAG

Curator Acknowledgements
Curator Description Most Recent Edit