fexA

Accession ARO:3002704
DefinitionfexA is a plasmid-encoded chloramphenicol exporter that is found in Staphylococcus lentus
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classtetracycline antibiotic, bicyclomycin, penam, lincosamide antibiotic, antibacterial free fatty acids, benzalkonium chloride, acridine dye, phenicol antibiotic, peptide antibiotic, glycylcycline, nitroimidazole antibiotic, rifamycin antibiotic, fosfomycin, fluoroquinolone antibiotic, nucleoside antibiotic, cephalosporin, diaminopyrimidine antibiotic, isoniazid, macrolide antibiotic, oxazolidinone antibiotic, rhodamine
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesStaphylococcus aureusp+wgs
Classification30 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
+ confers_resistance_to_antibiotic florfenicol [Antibiotic]
Publications

Kehrenberg C and Schwarz S. 2004. Antimicrob Agents Chemother 48(2): 615-618. fexA, a novel Staphylococcus lentus gene encoding resistance to florfenicol and chloramphenicol. (PMID 14742219)

Resistomes

Prevalence of fexA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Enterococcus faecalis8.11%6.19%6.98%
Enterococcus faecium0%0.18%2.69%
Listeria monocytogenes0%0%0.11%
Staphylococcus aureus1.18%0.08%2.13%
Staphylococcus epidermidis0%0%3.49%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 500


>gb|CAD70268.1|+|fexA [Staphylococcus lentus]
MKKDSKSKEMIQSEKRGSTRLLMMVLSLSVLVGAITADLVNPVLPLISKDLEASKSQVSWIVSGIALVLAIGVPIYGRISDFFELRKLYI
FAIMILASGSLLCAIAPNLPLLVLGRMVQGAGMSAIPVLSIIAISKVFPQGKRGGALGIIAGSIGVGTAAGPIFGGVVGQYLGWNALFWF
TFLLAIMIVIGAYYALPTIKPAESVGSNKNFDFIGGLFLGLTVGLLLFGITQGETSGFSSFSSLTSLIGSVVALVGFIWRIVTAENPFVP
PVLFNNKDYVNTVIIAFFSMFAYFAVLVFVPLLVVEVNGLSSGQAGMILLPGGVAVAILSPFVGRLSDRFGDKRLIITGMTLMGLSTLFL
STYASGASPLLVSVGVLGVGIAFAFTNSPANNAAVSALDADKVGVGMGIFQGALYLGAGTGAGMIGALLSARRDATEPINPLYILDAMSY
SDAFLAATGAILIALIAGLGLKKRG


>gb|AJ549214|+|177-1604|fexA [Staphylococcus lentus]
ATGAAAAAGGATAGTAAATCTAAAGAAATGATTCAATCTGAAAAAAGGGGTTCTACTAGGCTTTTAATGATGGTACTCTCCCTATCTGTA
CTTGTAGGTGCAATTACGGCTGATTTAGTCAATCCCGTACTTCCACTAATAAGCAAAGATTTAGAAGCTTCGAAATCTCAAGTGAGTTGG
ATAGTTAGTGGTATTGCACTTGTTCTTGCGATTGGAGTTCCGATTTATGGTCGAATCTCAGACTTTTTTGAGTTACGAAAGCTATATATC
TTTGCCATTATGATTCTGGCAAGTGGTAGTCTTTTATGTGCAATTGCCCCGAACCTCCCATTGTTGGTTTTGGGAAGAATGGTTCAGGGT
GCTGGGATGTCCGCAATTCCAGTTCTATCAATCATTGCAATTTCGAAGGTTTTCCCACAAGGAAAACGTGGGGGAGCTTTGGGAATTATC
GCAGGAAGTATTGGTGTTGGAACTGCTGCTGGTCCAATATTTGGTGGAGTAGTTGGTCAATATTTAGGGTGGAATGCCTTGTTTTGGTTC
ACATTTTTGTTAGCCATTATGATTGTTATTGGTGCCTACTACGCGTTACCGACAATTAAACCGGCAGAATCCGTAGGAAGCAATAAGAAC
TTTGATTTCATTGGTGGTTTATTCCTCGGCCTCACAGTAGGATTACTCCTTTTTGGCATCACTCAAGGAGAAACTTCTGGTTTTTCTTCG
TTCTCATCGTTAACTAGCCTAATTGGTTCTGTTGTAGCTTTGGTGGGATTTATTTGGAGAATTGTTACCGCAGAAAATCCATTTGTACCA
CCTGTCCTGTTCAATAACAAGGATTATGTCAATACGGTCATAATTGCATTTTTTTCGATGTTTGCTTATTTCGCTGTTCTTGTGTTCGTC
CCATTACTAGTCGTTGAGGTGAATGGACTCTCTTCTGGACAGGCTGGAATGATATTGTTGCCAGGTGGTGTGGCTGTTGCAATCTTATCT
CCCTTCGTTGGCCGTCTTTCTGATCGATTTGGGGATAAACGTCTGATAATTACTGGGATGACTCTGATGGGGCTGTCTACCTTATTCTTG
TCCACCTATGCATCTGGTGCTTCACCTCTGTTAGTTTCCGTGGGGGTCCTCGGAGTAGGGATTGCTTTTGCATTCACGAATTCTCCCGCA
AATAACGCCGCAGTAAGTGCACTCGATGCAGACAAGGTTGGTGTCGGAATGGGGATTTTCCAAGGTGCTTTGTACCTTGGAGCAGGAACT
GGAGCAGGTATGATTGGAGCATTATTATCCGCTCGACGTGATGCTACTGAGCCGATAAATCCATTATATATATTGGACGCTATGTCCTAC
TCAGATGCGTTCCTTGCAGCTACAGGGGCAATACTCATTGCCTTAATAGCTGGATTAGGTTTAAAAAAGCGTGGGTAA