lnuA

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002835
Synonym(s)linA
CARD Short NamelnuA
DefinitionlnuA is a plasmid-mediated nucleotidyltransferase found in Staphylococcus chromogenes.
AMR Gene Familylincosamide nucleotidyltransferase (LNU)
Drug Classlincosamide antibiotic
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONStaphylococcus (2)
GAZ
FOODON
ENVO
UBERON
Classification8 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic lincomycin [Antibiotic]
+ lincosamide nucleotidyltransferase (LNU) [AMR Gene Family]
+ confers_resistance_to_antibiotic pirlimycin [Antibiotic]
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Clostridium botulinumwgs, Enterococcus faecaliswgs, Enterococcus faeciumwgs, Enterococcus hiraewgs, Escherichia coliwgs, Helicobacter pyloriwgs, Lactobacillus crispatuswgs, Lactobacillus johnsoniig+wgs, Lactococcus garvieaep+wgs, Listeria innocuap+wgs, Listeria monocytogeneswgs, Macrococcoides canisp+wgs, Staphylococcus arlettaep+wgs, Staphylococcus aureusg+p+wgs, Staphylococcus capitiswgs, Staphylococcus epidermidisp+wgs, Staphylococcus equorump+wgs, Staphylococcus haemolyticuswgs, Staphylococcus hominiswgs, Staphylococcus pasteuriwgs, Staphylococcus pseudintermediuswgs, Staphylococcus saprophyticuswgs, Staphylococcus simulansp+wgs, Staphylococcus warnerip+wgs, Streptococcus pneumoniaewgs, Streptococcus suiswgs
Publications

Luthje P, et al. 2007. J Antimicrob Chemother 59(4): 600-606. Identification and characterization of nine novel types of small staphylococcal plasmids carrying the lincosamide nucleotidyltransferase gene lnu(A). (PMID 17329268)

Resistomes

Prevalence of lnuA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0%0%0.01%0%0%
Clostridium botulinum0%0%0.27%0%0%
Enterococcus faecalis0%0%0.16%0%0%
Enterococcus faecium0%0%0.14%0%0%
Enterococcus hirae0%0%0.46%0%0%
Escherichia coli0%0%0.06%0%1.29%
Helicobacter pylori0%0%0.05%0%0%
Lactobacillus crispatus0%0%3.72%0%0%
Lactobacillus johnsonii33.33%0%17.24%0%0%
Lactococcus garvieae0%4.17%2.22%0%0%
Listeria innocua0%5.26%0.75%0%0%
Listeria monocytogenes0%0%0.05%0%0%
Macrococcoides canis0%6.25%12.5%0%0%
Staphylococcus arlettae0%8.33%10%0%0%
Staphylococcus aureus0.09%0.74%2.03%0%0%
Staphylococcus capitis0%0%3.8%0%0%
Staphylococcus epidermidis0%0.86%4.35%0%0%
Staphylococcus equorum0%10.81%16.07%0%0%
Staphylococcus haemolyticus0%0%10.55%0%0%
Staphylococcus hominis0%0%11.22%0%0%
Staphylococcus pasteuri0%0%7.69%0%0%
Staphylococcus pseudintermedius0%0%1.03%0%0%
Staphylococcus saprophyticus0%0%12.59%0%0%
Staphylococcus simulans0%23.53%3.39%0%0%
Staphylococcus warneri0%7.5%11.48%0%0%
Streptococcus pneumoniae0%0%0.03%0%0%
Streptococcus suis0%0%0.1%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300


>gb|AAA26652.1|+|lnuA [Staphylococcus haemolyticus]
MKNNNVTEKELFYILDLFEHMKVTYWLDGGWGVDVLTGKQQREHRDIDIDFDAQHTQKVIQKLEDIGYKIEVHWMPSRMELKHEEYGYLD
IHPINLNDDGSITQANPEGGNYVFQNDWFSETNYKDRKIPCISKEAQLLFHSGYDLTETDHFDIKNLKSIT


>gb|M14039.1|+|413-898|lnuA [Staphylococcus haemolyticus]
ATGAAAAATAATAATGTAACAGAAAAAGAATTATTTTATATTTTAGATTTATTTGAACACATGAAAGTAACTTATTGGTTAGATGGTGGC
TGGGGGGTAGATGTATTAACTGGAAAACAACAAAGAGAACACAGAGATATAGATATAGATTTTGACGCTCAACACACTCAAAAAGTTATA
CAAAAATTAGAAGATATAGGATACAAAATAGAAGTTCATTGGATGCCTTCACGTATGGAACTTAAGCATGAAGAATATGGGTATTTAGAT
ATTCATCCTATAAATCTAAATGATGATGGATCAATTACCCAAGCAAACCCAGAAGGTGGTAATTATGTTTTCCAAAATGACTGGTTTTCA
GAAACTAATTACAAAGATCGAAAAATACCATGTATTTCAAAAGAAGCTCAACTTCTTTTTCATTCTGGTTATGATTTAACAGAAACAGAC
CATTTTGATATAAAAAATTTAAAATCAATAACATAA

Curator Acknowledgements
Curator Description Most Recent Edit