linG

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002879
CARD Short NamelinG
DefinitionlinG is an integron-associated gene cassette, with aadA2, encoding a lincosomide nucleotidyltransferase found in Salmonella enterica. linG confers resistance to lincosomide antibiotics.
AMR Gene Familylincosamide nucleotidyltransferase (LNU)
Drug Classlincosamide antibiotic
Resistance Mechanismantibiotic inactivation
Classification8 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic lincomycin [Antibiotic]
+ lincosamide nucleotidyltransferase (LNU) [AMR Gene Family]
Resistomes with Perfect MatchesCitrobacter freundiiwgs, Enterobacter asburiaewgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter roggenkampiip, Escherichia albertiip+wgs, Escherichia colig+p+wgs, Escherichia fergusoniiwgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaewgs, Proteus mirabilisg+wgs+gi, Proteus penneriwgs, Proteus vulgarisp, Providencia rettgeriwgs, Salmonella entericag+p+wgs, Shigella flexnerip, Shigella sonneiwgs
Resistomes with Sequence VariantsCitrobacter freundiiwgs, Enterobacter asburiaewgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter roggenkampiip, Escherichia albertiip+wgs, Escherichia colig+p+wgs, Escherichia fergusoniig+p+wgs, Klebsiella oxytocap, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaewgs, Proteus mirabilisg+wgs+gi, Proteus penneriwgs, Proteus vulgarisp, Providencia rettgerig+p+wgs, Salmonella entericag+p+wgs, Shigella boydiiwgs, Shigella flexnerip, Shigella sonneiwgs
Publications

Levings RS, et al. 2006. Antimicrob Agents Chemother 50(10): 3514-3515. linG, a new integron-associated gene cassette encoding a lincosamide nucleotidyltransferase. (PMID 17005845)

Resistomes

Prevalence of linG among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Citrobacter freundii0%0%0.39%0%0%
Enterobacter asburiae0%0%0.79%0%0%
Enterobacter cloacae0%0.56%0.96%0%0%
Enterobacter hormaechei0%0.06%0.35%0%0%
Enterobacter roggenkampii0%0.48%0%0%0%
Escherichia albertii0%0.56%0.65%0%0%
Escherichia coli0.05%0.47%2.02%0%0.13%
Escherichia fergusonii1.64%0.71%18.48%0%0%
Klebsiella oxytoca0%0.68%0%0%0%
Klebsiella pneumoniae0%0.02%0.2%0%0%
Klebsiella quasipneumoniae0%0%1.18%0%0%
Proteus mirabilis2.75%0%6.77%3.7%0%
Proteus penneri0%0%12.5%0%0%
Proteus vulgaris0%11.11%0%0%0%
Providencia rettgeri2.94%2.7%8.28%0%0%
Salmonella enterica0.88%1.97%1.29%0%0%
Shigella boydii0%0%1.11%0%0%
Shigella flexneri0%1.2%0%0%0%
Shigella sonnei0%0%0.44%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|ABG65740.1|+|linG [Salmonella enterica subsp. enterica serovar Stanley]
MLQLKMIELFKEGCHEDARIIAALMFGSFAIGEGDEFSDIEFAVFIQDDHFENFDQRSWLNAVSPVAAYFPDDFGHHTALFENGIRGEFH
FMRKSDIPVISTWQGYGWFPSLEAAVLLDRSGELSRYASALVGGPPIREGAPLVEGLVLNLISLMLFGANLLNRGEYARAWALLSKAHEN
LLKLVRLHEGATDHWPTPSRALEKDISEDSYNRYLACTSSAEPRALCAAYHQTWTWSLELFKSVTEPLNIELPRTVIAQAKRLLNESATP
HNK


>gb|DQ836009.1|+|1310-2131|linG [Salmonella enterica subsp. enterica serovar Stanley]
ATGCTTCAGCTGAAAATGATCGAACTCTTCAAGGAAGGTTGTCATGAGGATGCACGAATAATCGCGGCATTGATGTTCGGCTCATTTGCT
ATCGGAGAGGGTGACGAGTTCTCTGATATCGAATTCGCAGTGTTCATCCAGGATGACCATTTTGAAAATTTCGATCAGCGCTCGTGGCTT
AATGCCGTAAGTCCGGTTGCTGCTTACTTTCCGGACGACTTCGGCCACCACACCGCACTTTTTGAAAACGGCATTCGCGGTGAATTCCAT
TTCATGCGAAAATCGGACATACCGGTCATTTCCACTTGGCAAGGCTATGGGTGGTTTCCCTCGCTTGAGGCGGCTGTTTTGTTGGACCGA
TCAGGAGAGTTGTCAAGGTACGCAAGCGCTCTCGTGGGCGGTCCCCCGATACGTGAAGGCGCGCCGCTGGTGGAAGGGCTTGTGTTGAAC
CTCATCAGCCTGATGCTCTTTGGGGCCAATCTTTTAAATCGGGGAGAGTACGCTCGCGCCTGGGCTTTGCTCAGCAAAGCACATGAAAAC
CTACTCAAGCTGGTTCGACTCCACGAAGGGGCAACAGACCACTGGCCGACACCTTCACGCGCGCTCGAAAAGGATATCTCGGAGGACTCG
TATAATCGCTATCTGGCATGCACAAGCAGTGCAGAACCAAGAGCACTATGTGCAGCCTATCATCAAACGTGGACGTGGAGTCTCGAATTG
TTCAAGAGCGTGACAGAACCTCTGAATATCGAGCTTCCGAGAACTGTAATTGCGCAGGCAAAAAGGTTGCTCAATGAGTCTGCGACGCCG
CACAACAAGTAA

Curator Acknowledgements
Curator Description Most Recent Edit