SAT-2

Accession ARO:3002895
CARD Short NameSAT-2
DefinitionSAT-2 is a plasmid-mediated streptothricin acetyltransferase, which confers resistance to streptothricin, a nucleoside antibiotic. Originally described from an E. coli plasmid sequence by Heim et al., 1989.
AMR Gene Familystreptothricin acetyltransferase (SAT)
Drug Classnucleoside antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesAcinetobacter baumanniig+p+wgs+gi, Acinetobacter indicusp, Acinetobacter lwoffiiwgs, Acinetobacter townerip+wgs, Actinobacillus pleuropneumoniaewgs, Aeromonas caviaeg, Aeromonas hydrophilag, Alcaligenes faecaliswgs, Citrobacter freundiig+wgs+gi, Citrobacter portucalensisg+wgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Enterobacter asburiaewgs, Enterobacter cloacaeg+wgs, Enterobacter hormaecheiwgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Escherichia albertiiwgs, Escherichia colig+p+wgs+gi, Escherichia fergusoniip+wgs, Klebsiella michiganensiswgs, Klebsiella oxytocag+wgs, Klebsiella pneumoniaeg+p+wgs+gi, Klebsiella quasipneumoniaewgs, Morganella morganiig+wgs+gi, Neisseria brasiliensisg+gi, Proteus columbaeg+gi, Proteus mirabilisg+p+wgs+gi, Proteus penneriwgs, Proteus vulgarisg+wgs+gi, Providencia heimbachaeg+wgs+gi, Providencia rettgerig+p+wgs, Providencia stuartiig+wgs+gi, Pseudomonas aeruginosawgs, Raoultella planticolawgs, Salmonella entericag+wgs, Serratia liquefacienswgs, Serratia marcescenswgs, Shigella boydiig+wgs, Shigella dysenteriaeg+wgs, Shigella flexnerig+p+wgs+gi, Shigella sonneig+p+wgs+gi, Vibrio choleraewgs, Vibrio fluvialiswgs, Vibrio vulnificuswgs, Yersinia enterocoliticawgs
Resistomes with Sequence VariantsAcinetobacter baumanniig+p+wgs+gi, Acinetobacter indicusp, Acinetobacter lwoffiiwgs, Acinetobacter townerip+wgs, Actinobacillus pleuropneumoniaewgs, Aeromonas caviaeg, Aeromonas hydrophilag, Alcaligenes faecaliswgs, Citrobacter freundiig+wgs+gi, Citrobacter portucalensisg+wgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Enterobacter asburiaewgs, Enterobacter cloacaeg+wgs, Enterobacter hormaecheiwgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Escherichia albertiiwgs, Escherichia colig+p+wgs+gi, Escherichia fergusoniip+wgs, Klebsiella michiganensiswgs, Klebsiella oxytocag+wgs, Klebsiella pneumoniaeg+p+wgs+gi, Klebsiella quasipneumoniaewgs, Morganella morganiig+wgs+gi, Neisseria brasiliensisg+gi, Proteus columbaeg+gi, Proteus mirabilisg+p+wgs+gi, Proteus penneriwgs, Proteus vulgarisg+wgs+gi, Providencia heimbachaeg+wgs+gi, Providencia rettgerig+p+wgs, Providencia stuartiig+wgs+gi, Pseudomonas aeruginosawgs, Raoultella planticolawgs, Salmonella entericag+wgs, Serratia liquefacienswgs, Serratia marcescenswgs, Shigella boydiig+wgs, Shigella dysenteriaeg+wgs, Shigella flexnerig+p+wgs+gi, Shigella sonneig+p+wgs+gi, Vibrio choleraewgs, Vibrio fluvialiswgs, Vibrio vulnificuswgs, Yersinia enterocoliticawgs
Classification8 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic streptothricin [Antibiotic]
+ streptothricin acetyltransferase (SAT) [AMR Gene Family]
Publications

Heim U, et al. 1989. Nucleic Acids Res 17(17): 7103. Nucleotide sequence of a plasmid born streptothricin-acetyl-transferase gene (sat-1). (PMID 2550905)

Tietze E, et al. 1990. Nucleic Acids Res 18(5): 1283. Nucleotide sequence of the streptothricin-acetyl-transferase gene sat-2. (PMID 2157196)

Resistomes

Prevalence of SAT-2 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii1.42%0.16%4.11%1.26%0%
Acinetobacter indicus0%3.77%0%0%0%
Acinetobacter lwoffii0%0%2.63%0%0%
Acinetobacter towneri0%18.75%7.69%0%0%
Actinobacillus pleuropneumoniae0%0%4.76%0%0%
Aeromonas caviae2.27%0%0%0%0%
Aeromonas hydrophila1.54%0%0%0%0%
Alcaligenes faecalis0%0%8.82%0%0%
Citrobacter freundii12.3%0%19.54%36.36%0%
Citrobacter portucalensis3.7%0%1.8%0%0%
Citrobacter werkmanii0%0%2.56%0%0%
Citrobacter youngae0%0%6.25%0%0%
Enterobacter asburiae0%0%2.37%0%0%
Enterobacter cloacae1.79%0%3.51%0%0%
Enterobacter hormaechei0%0%2.37%0%0%
Enterobacter kobei0%0%0.87%0%0%
Enterobacter roggenkampii0%0%0.36%0%0%
Escherichia albertii0%0%0.65%0%0%
Escherichia coli1.1%0.07%2.65%1.28%3.99%
Escherichia fergusonii0%0.71%3.26%0%0%
Klebsiella michiganensis0%0%2.93%0%0%
Klebsiella oxytoca5.13%0%13.03%0%0%
Klebsiella pneumoniae2.96%0.07%1.9%2.86%0%
Klebsiella quasipneumoniae0%0%0.26%0%0%
Morganella morganii19.23%0%14.72%23.08%0%
Neisseria brasiliensis100%0%0%50%0%
Proteus columbae100%0%0%50%0%
Proteus mirabilis28.44%2.5%36.63%22.22%0%
Proteus penneri0%0%12.5%0%0%
Proteus vulgaris27.27%0%22.22%100%0%
Providencia heimbachae50%0%14.29%100%0%
Providencia rettgeri23.53%10.81%33.76%0%0%
Providencia stuartii6.25%0%13.64%33.33%0%
Pseudomonas aeruginosa0%0%0.03%0%0%
Raoultella planticola0%0%5.13%0%0%
Salmonella enterica0.06%0%0.44%0%0%
Serratia liquefaciens0%0%3.17%0%0%
Serratia marcescens0%0%7.73%0%0%
Shigella boydii13.33%0%24.44%0%0%
Shigella dysenteriae21.43%0%20%0%0%
Shigella flexneri17%0.4%63.51%11.9%0%
Shigella sonnei70.73%0.97%75.24%23.81%0%
Vibrio cholerae0%0%0.19%0%0%
Vibrio fluvialis0%0%1.33%0%0%
Vibrio vulnificus0%0%0.41%0%0%
Yersinia enterocolitica0%0%5.45%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300


>gb|BAD95494.1|+|SAT-2 [Escherichia coli]
MKISVIPEQVAETLDAENHFIVREVFDVHLSDQGFELSTRSVSPYRKDYISDDDSDEDSACYGAFIDQELVGKIELNSTWNDLASIEHIV
VSHTHRGKGVAHSLIEFAKKWALSRQLLGIRLETQTNNVPACNLYAKCGFTLGGIDLFTYKTRPQVSNETAMYWYWFSGAQDDA


>gb|AB211124.1|+|1-525|SAT-2 [Escherichia coli]
ATGAAGATTTCGGTGATCCCTGAGCAGGTGGCGGAAACATTGGATGCTGAGAACCATTTCATTGTTCGTGAAGTGTTCGATGTGCACCTA
TCCGACCAAGGCTTTGAACTATCTACCAGAAGTGTGAGCCCCTACCGGAAGGATTACATCTCGGATGATGACTCTGATGAAGACTCTGCT
TGCTATGGCGCATTCATCGACCAAGAGCTTGTCGGGAAGATTGAACTCAACTCAACATGGAACGATCTAGCCTCTATCGAACACATTGTT
GTGTCGCACACGCACCGAGGCAAAGGAGTCGCGCACAGTCTCATCGAATTTGCGAAAAAGTGGGCACTAAGCAGACAGCTCCTTGGCATA
CGATTAGAGACACAAACGAACAATGTACCTGCCTGCAATTTGTACGCAAAATGTGGCTTTACTCTCGGCGGCATTGACCTGTTCACGTAT
AAAACTAGACCTCAAGTCTCGAACGAAACAGCGATGTACTGGTACTGGTTCTCGGGAGCACAGGATGACGCCTAA

Curator Acknowledgements
Curator Description Most Recent Edit