SAT-4

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002897
CARD Short NameSAT-4
DefinitionSAT-4 is a plasmid-mediated streptothricin acetyltransferase and streptothricin (a nucleoside antibiotic) resistant determinant. Originally described from a Campylobacter coli BE/G4 plasmid gene sequence by Jacob et al, 1994.
AMR Gene Familystreptothricin acetyltransferase (SAT)
Drug Classnucleoside antibiotic
Resistance Mechanismantibiotic inactivation
Classification8 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic streptothricin [Antibiotic]
+ streptothricin acetyltransferase (SAT) [AMR Gene Family]
Resistomes with Sequence VariantsAliarcobacter butzlerig+p+wgs, Bacteroides fragiliswgs, Bacteroides thetaiotaomicronwgs, Bifidobacterium breveg+wgs, Bifidobacterium longumg+wgs, Campylobacter colig+p+wgs, Campylobacter jejunig+p+wgs, Clostridioides difficilegi, Enterococcus aviump+wgs, Enterococcus faecalisg+p+wgs+gi, Enterococcus faeciumg+p+wgs+gi, Enterococcus hiraep+wgs, Erysipelothrix rhusiopathiaeg+gi, Escherichia coliwgs, Eubacterium limosumwgs, Fusobacterium necrophorumwgs, Klebsiella aerogeneswgs, Klebsiella pneumoniaewgs, Lachnospiraceae bacteriumgi, Listeria monocytogeneswgs, Neisseria brasiliensisg+gi, Parabacteroides distasoniswgs, Phocaeicola vulgatuswgs, Staphylococcus aureusg+p+wgs+gi, Staphylococcus epidermidisg+p+wgs, Staphylococcus haemolyticusg+wgs+gi, Staphylococcus hominisp+wgs, Staphylococcus pseudintermediusg+wgs+gi, Staphylococcus saprophyticuswgs, Staphylococcus warneriwgs, Streptococcus agalactiaewgs+gi, Streptococcus dysgalactiaeg+wgs, Streptococcus equiwgs, Streptococcus gallolyticuswgs, Streptococcus mitisg, Streptococcus pasteurianusg+wgs+gi, Streptococcus pneumoniaeg+wgs, Streptococcus pyogenesg+wgs+gi, Streptococcus suisg+wgs
Publications

Jacob J, et al. 1994. FEMS Microbiol Lett 120(1-2): 13-17. Characterization of the sat4 gene encoding a streptothricin acetyltransferase in Campylobacter coli BE/G4. (PMID 8056285)

Resistomes

Prevalence of SAT-4 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Aliarcobacter butzleri12.5%33.33%0.81%0%0%
Bacteroides fragilis0%0%0.27%0%0%
Bacteroides thetaiotaomicron0%0%3.5%0%0%
Bifidobacterium breve5.88%0%1.81%0%0%
Bifidobacterium longum6.32%0%0.21%0%0%
Campylobacter coli4.35%6.36%7.74%0%0%
Campylobacter jejuni2.81%5.94%2.47%0%0%
Clostridioides difficile0%0%0%8.33%0%
Enterococcus avium0%33.33%3.51%0%0%
Enterococcus faecalis8.64%9.85%19.08%4.17%0%
Enterococcus faecium3.5%8.03%30.13%3.92%0%
Enterococcus hirae0%2.38%2.31%0%0%
Erysipelothrix rhusiopathiae27.27%0%0%66.67%0%
Escherichia coli0%0%0.01%0%0%
Eubacterium limosum0%0%25%0%0%
Fusobacterium necrophorum0%0%6.98%0%0%
Klebsiella aerogenes0%0%0.28%0%0%
Klebsiella pneumoniae0%0%0.03%0%0%
Lachnospiraceae bacterium0%0%0%33.33%0%
Listeria monocytogenes0%0%0.02%0%0%
Neisseria brasiliensis100%0%0%50%0%
Parabacteroides distasonis0%0%0.93%0%0%
Phocaeicola vulgatus0%0%1.11%0%0%
Staphylococcus aureus4.54%2.86%15.88%6.02%0%
Staphylococcus epidermidis0.65%0.58%2.85%0%0%
Staphylococcus haemolyticus34.48%0%29.45%20%0%
Staphylococcus hominis0%2.08%2.93%0%0%
Staphylococcus pseudintermedius48.33%0%67.44%6.67%0%
Staphylococcus saprophyticus0%0%0.7%0%0%
Staphylococcus warneri0%0%6.56%0%0%
Streptococcus agalactiae0%0%2.77%33.33%0%
Streptococcus dysgalactiae2%0%1.87%0%0%
Streptococcus equi0%0%0.23%0%0%
Streptococcus gallolyticus0%0%9.09%0%0%
Streptococcus mitis11.11%0%0%0%0%
Streptococcus pasteurianus25%0%10%16.67%0%
Streptococcus pneumoniae0.97%0%0.56%0%0%
Streptococcus pyogenes1.12%0%0.93%18.18%0%
Streptococcus suis6.4%0%7.19%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300


>gb|AAB53445.1|+|SAT-4 [Campylobacter coli]
MITEMKAEHLKDIDKPSEPFEVIGKIIPRYENENWTFTELLYEAPYLKSYQDEEDEEDEEADCLEYIDNTDKIIYLYYQDDKCVGKVKLR
KNWNRYAYIEDIAVCKDFRGQGIGSALINISIEWAKHKNLHGLMLETQDNNLIACKFYHNCGFKIGSVDTMLYANFENNFEKAVFWYLRF


>gb|U01945.1|+|374-916|SAT-4 [Campylobacter coli]
GTGATTACAGAAATGAAAGCAGAGCACCTGAAAGATATCGATAAACCCAGCGAACCATTTGAGGTGATAGGTAAGATTATACCGAGGTAT
GAAAACGAGAATTGGACCTTTACAGAATTACTCTATGAAGCGCCATATTTAAAAAGCTACCAAGACGAAGAGGATGAAGAGGATGAGGAG
GCAGATTGCCTTGAATATATTGACAATACTGATAAGATAATATATCTTTACTACCAAGACGATAAATGCGTCGGAAAAGTTAAACTGCGA
AAAAATTGGAACCGGTACGCTTATATAGAAGATATCGCCGTATGTAAGGATTTCAGGGGGCAAGGCATAGGCAGCGCGCTTATCAATATA
TCTATAGAATGGGCAAAGCATAAAAACTTGCATGGACTAATGCTTGAAACCCAGGACAATAACCTTATAGCTTGTAAATTCTATCATAAT
TGTGGTTTCAAAATCGGCTCCGTCGATACTATGTTATACGCCAACTTTGAAAACAACTTTGAAAAAGCTGTTTTCTGGTATTTAAGGTTT
TAG

Curator Acknowledgements
Curator Description Most Recent Edit