Enterococcus faecalis liaF mutant conferring daptomycin resistance

Accession ARO:3003077
CARD Short NameEfae_liaF_DAP
DefinitionliaF is an accessory protein that acts as a negative regulator of liaRS signal transduction pathway. Mutations confer daptomycin resistance.
AMR Gene Familydaptomycin resistant liaF
Drug Classpeptide antibiotic
Resistance Mechanismantibiotic efflux, antibiotic target alteration
Efflux Regulatorprotein(s) and two-component regulatory system modulating antibiotic efflux
Classification12 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic daptomycin [Antibiotic]
+ antibiotic resistant liaFSR system
+ daptomycin resistant liaF [AMR Gene Family]
Publications

Arias CA, et al. 2011. N Engl J Med 365(10): 892-900. Genetic basis for in vivo daptomycin resistance in enterococci. (PMID 21899450)

Miller C, et al. 2013. Antimicrob Agents Chemother 57(11): 5373-5383. Adaptation of Enterococcus faecalis to daptomycin reveals an ordered progression to resistance. (PMID 23959318)

Resistomes

Prevalence of Enterococcus faecalis liaF mutant conferring daptomycin resistance among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
No prevalence data


Detection Models

Model Type: protein variant model

Model Definition: Protein Variant Models (PVM) perform a similar search as Protein Homolog Models (PHM), i.e. detect protein sequences based on their similarity to a curated reference sequence, but secondarily screen query sequences for curated sets of mutations to differentiate them from antibiotic susceptible wild-type alleles. PVMs are designed to detect AMR acquired via mutation of house-keeping genes or antibiotic targets, e.g. a mutated gyrase resistant to aminocoumarin antibiotics. PVMs include a protein reference sequence (often from antibiotic susceptible wild-type alleles), a curated bit-score cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of single point mutations, insertions, or deletions curated from the scientific literature. A Strict RGI match has a BLASTP bit-score above the curated BLASTP cutoff value and contains at least one curated mutation from amongst the mapped resistance variants, while a Loose RGI match has a bit-score less than the curated BLASTP bit-score cut-off but still contains at least one curated mutation from amongst the mapped resistance variants.

Bit-score Cut-off (blastP): 400

PubMed: mutation data hand curated from the scientific literature, evaluated as conferring resistance (R). CRyPTIC: mutation data acquired from the CRyPTIC catalog, evaluated as resistant (R), susceptible (S), or undetermined (U). ReSeqTB: mutation data acquired from the ReSeqTB catalog, evaluated as conferring resistance (Minimal, Moderate, High), not conferring resistance (None), or Indeterminate. WHO: mutation data acquired from the WHO 2023 catalog, evaluated as resistant (R), susceptible (S), or undetermined (U).

MutationMutation typePubMed
+I177insertion mutation from peptide sequencePMID:23959318
-I177deletion mutation from peptide sequencePMID:23959318
T194Isingle resistance variantPMID:23959318

>gb|WP_002381168.1|-|Enterococcus faecalis liaF mutant conferring daptomycin resistance [Enterococcus faecalis V583]
MNNPWRFFIVAEALLFILALWQIVHNPGLAVLLTIGVLLVAYVSRKASKTHFNNFQFVLG
VVFIVIGAMNSTAVWFMLIFGVLFIGLKGFEISGVDIAERAPWRKKQMIMVETAAKEPKN
GKRFKRRWFANERIGNNIYEWDDINIDLISGDTIIDLGNTLLPKEDNIIIIRKGFGRTRI
LVPLGVAILLEHSTFYGTVRFEEEKYQLKNESLKIYSNDYDTNLRRLKIMTNTLVGDVEV
IRV



>gb|NC_004668.1|-|2790821-2791552|Enterococcus faecalis liaF mutant conferring daptomycin resistance [Enterococcus faecalis V583]
ATGAATAACCCTTGGCGCTTTTTTATCGTCGCAGAAGCATTACTTTTTATTCTGGCGTTATGGCAAATTGTACATAATCCTGGATTAGCT
GTTTTATTAACAATTGGCGTTTTACTTGTGGCCTACGTTTCCAGGAAAGCATCTAAAACACATTTTAACAACTTTCAATTCGTCCTCGGC
GTTGTTTTTATTGTCATTGGTGCAATGAATAGCACGGCTGTTTGGTTTATGTTGATTTTTGGCGTACTCTTTATCGGCTTAAAAGGCTTT
GAGATTTCAGGCGTGGATATAGCTGAGCGAGCACCTTGGCGAAAAAAACAAATGATTATGGTGGAGACGGCGGCAAAAGAACCTAAAAAT
GGCAAACGGTTTAAACGCCGCTGGTTTGCCAACGAACGCATTGGTAACAATATCTATGAATGGGACGATATCAATATTGATTTAATCTCT
GGGGACACCATTATTGATTTAGGTAATACGCTACTACCGAAAGAAGACAATATTATTATTATTCGTAAAGGTTTTGGCCGCACGCGAATT
CTAGTGCCGTTAGGTGTAGCTATTTTGTTAGAACATTCAACTTTTTACGGAACGGTACGTTTTGAAGAAGAAAAATATCAATTGAAAAAC
GAATCATTAAAAATTTACAGCAATGATTATGATACCAATCTTCGTCGTTTGAAAATTATGACGAACACTTTAGTAGGAGATGTTGAGGTG
ATCCGTGTATGA

Curator Acknowledgements
Curator Description Most Recent Edit