tet(45)

Accession ARO:3003196
Synonym(s)tet45
Definitiontet45 is a tetracycline efflux pump found in Bhargavaea cecembensis strain previously isolated from a poultry-litter-impacted soil.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classtetracycline antibiotic, isoniazid, benzalkonium chloride, glycylcycline, rhodamine, antibacterial free fatty acids, phenicol antibiotic, lincosamide antibiotic, macrolide antibiotic, bicyclomycin, nitroimidazole antibiotic, peptide antibiotic, penam, fosfomycin, fluoroquinolone antibiotic, diaminopyrimidine antibiotic, rifamycin antibiotic, acridine dye, cephalosporin, oxazolidinone antibiotic, nucleoside antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Classification30 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic tetracycline [Antibiotic]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
Publications

Michael GB, et al. 2011. J Antimicrob Chemother 67(1): 84-90. ICEPmu1, an integrative conjugative element (ICE) of Pasteurella multocida: analysis of the regions that comprise 12 antimicrobial resistance genes. (PMID 22001175)

You Y, et al. 2013. J Antimicrob Chemother 68(9): 1962-1969. Identification of Tet45, a tetracycline efflux pump, from a poultry-litter-exposed soil isolate and persistence of tet(45) in the soil. (PMID 23595824)

Resistomes

Prevalence of tet(45) among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Bacillus anthracis0%0%1.23%
Enterococcus faecalis0%7.08%33.46%
Enterococcus faecium28.8%2.83%35.12%
Staphylococcus aureus2.13%0.81%5.11%
Staphylococcus epidermidis0%0%3.49%
Staphylococcus pseudintermedius0%0%2.03%
Streptococcus agalactiae2.25%0%0.29%
Streptococcus anginosus0%0%7.69%
Streptococcus pyogenes1.18%0%9.8%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 450


>gb|AEM62948.1|-|tet(45) [Bhargavaea cecembensis]
MNTPHSHSNLRHNQILLWLCVLSFFSVLNEMVLNVSLPDIASDFNKEPASINWVNSSFILTFSIGTAVYGKLSDQLGIKKLLLFGIIVNC
FGSVIGFVGHFFFPVLILARFIQGVGAAAFPALVMVVIARYIPKENRGKAFGIIGSIVTMGEGVGPSVGGVIAEYAHWSYILLLPVVTII
TVPFLAKLLKQEEVIKGSFDTKGIIFMSVGIVFFIMFTTCYRVSFLVVSIICFLIFVKNIRKVSNPFINPSLGKNVSFMIGIICGGLIFG
TVAGFISMVPYMMKDVYQLSTAAIGSGIIFPGAMSVIVFGYIGGLLVDKKGSLFVLTTGVAFLSISFLVAALFIETTPWLITIILIFVFG
GLSFTKTVISTIVSSSLEQKEAGAGMSLLNFTSFLSEGTGIAIVGGLLSIHLLNRKLLPINAEPSTHLYSNLLLLFAGITIISWLVTIKM
HKRSRGNI


>gb|JF837330.1|-|1967-3343|tet(45) [Bhargavaea cecembensis]
GTGAATACACCTCATTCACATTCAAATTTGCGCCATAATCAAATTTTATTATGGCTCTGTGTTCTTTCTTTTTTCAGCGTTTTAAATGAA
ATGGTTTTGAATGTTTCATTACCTGATATTGCTAGTGATTTTAATAAGGAACCAGCAAGTATAAACTGGGTAAACTCATCGTTCATATTA
ACTTTTTCTATAGGAACAGCTGTATATGGAAAGCTATCGGACCAGCTAGGAATAAAAAAGCTACTCCTATTTGGGATTATAGTAAATTGC
TTCGGATCAGTTATCGGGTTTGTTGGACATTTTTTCTTTCCCGTACTTATTTTGGCTCGGTTTATTCAGGGAGTTGGCGCAGCTGCATTT
CCAGCACTTGTGATGGTGGTTATTGCGCGCTATATTCCAAAAGAAAATAGGGGTAAAGCATTTGGTATTATTGGGTCCATTGTAACTATG
GGAGAAGGTGTCGGACCATCTGTTGGTGGAGTGATTGCCGAATATGCCCATTGGTCTTATATACTGCTTTTGCCTGTTGTAACGATTATC
ACTGTTCCATTCCTTGCAAAATTATTGAAACAGGAAGAGGTAATAAAAGGATCTTTTGATACTAAAGGAATAATATTTATGTCCGTAGGC
ATTGTATTTTTTATAATGTTTACGACATGTTATAGAGTTTCCTTTCTAGTCGTTAGCATAATATGTTTCTTAATATTTGTTAAGAATATT
AGGAAAGTGTCTAATCCTTTTATTAATCCTTCGCTAGGAAAAAATGTCTCATTTATGATTGGAATCATTTGTGGAGGACTTATATTTGGA
ACCGTAGCAGGATTTATTTCTATGGTCCCTTATATGATGAAAGATGTCTATCAATTAAGTACTGCTGCAATTGGAAGTGGGATTATTTTT
CCTGGGGCAATGAGTGTTATTGTTTTCGGTTATATTGGGGGATTGCTTGTTGATAAGAAAGGTTCACTATTTGTATTAACAACTGGAGTT
GCATTTCTTTCTATAAGCTTTTTAGTAGCTGCCCTTTTTATAGAAACAACGCCTTGGCTTATAACAATTATATTAATTTTTGTTTTTGGG
GGGCTTTCTTTTACGAAAACAGTTATATCCACCATTGTTTCAAGTAGTTTGGAACAAAAGGAAGCTGGTGCTGGAATGAGTTTGCTTAAT
TTCACAAGCTTTTTATCAGAAGGAACAGGTATTGCAATTGTAGGTGGATTATTATCGATACATTTGCTAAATCGAAAATTACTACCTATA
AATGCTGAGCCATCCACTCATTTGTATAGTAATTTGCTATTACTTTTTGCAGGAATCACAATTATTAGCTGGTTGGTTACTATAAAAATG
CATAAACGCTCAAGAGGAAATATATAA