tet(45)

Accession ARO:3003196
Synonym(s)tet45
CARD Short Nametet(45)
DefinitionTet45 is a tetracycline efflux pump found in Bhargavaea cecembensis strain previously isolated from a poultry-litter-impacted soil.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classtetracycline antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Resistomes with Sequence VariantsActinobacillus pleuropneumoniaewgs, Aliarcobacter butzlerig+wgs, Anaerostipes hadruswgs, Bacillus amyloliquefaciensg+wgs+gi, Bacillus anthracisg+wgs, Bacillus cereusg+p+wgs, Bacillus subtilisg+p+wgs+gi, Bacillus tequilensisg+wgs, Bacillus thuringiensisp+wgs, Bacillus velezensisg+wgs+gi, Brevibacillus laterosporuswgs, Campylobacter colig+wgs+gi, Campylobacter jejunig+p+wgs+gi, Enterococcus faecalisg+p+wgs, Enterococcus faeciumg+p+wgs+gi, Enterococcus hiraeg+p+wgs, Gardnerella vaginalisg, Klebsiella pneumoniaewgs, Lactobacillus johnsoniig+wgs, Lactococcus garvieaep+wgs, Listeria monocytogeneswgs, Megasphaera stantoniiwgs, Morganella morganiip, Providencia alcalifacienswgs, Pseudomonas aeruginosawgs, Rhizobium leguminosarumwgs, Staphylococcus arlettaewgs, Staphylococcus aureusg+p+wgs+gi, Staphylococcus capitiswgs, Staphylococcus epidermidisp+wgs, Staphylococcus haemolyticusp+wgs, Staphylococcus hominisg+p+wgs, Staphylococcus pasteurip, Staphylococcus pseudintermediuswgs, Staphylococcus saprophyticuswgs, Staphylococcus simulanswgs, Staphylococcus warnerip+wgs, Streptococcus agalactiaeg+wgs, Streptococcus anginosusg+wgs, Streptococcus gallolyticusg+p+wgs, Streptococcus lutetiensiswgs, Streptococcus pasteurianusg+wgs+gi, Streptococcus pyogenesg+wgs, Streptococcus suisg+wgs, Streptococcus uberiswgs
Classification7 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
+ confers_resistance_to_antibiotic tetracycline [Antibiotic]
Publications

Michael GB, et al. 2011. J Antimicrob Chemother 67(1): 84-90. ICEPmu1, an integrative conjugative element (ICE) of Pasteurella multocida: analysis of the regions that comprise 12 antimicrobial resistance genes. (PMID 22001175)

You Y, et al. 2013. J Antimicrob Chemother 68(9): 1962-1969. Identification of Tet45, a tetracycline efflux pump, from a poultry-litter-exposed soil isolate and persistence of tet(45) in the soil. (PMID 23595824)

Resistomes

Prevalence of tet(45) among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Actinobacillus pleuropneumoniae0%0%2.38%0%
Aliarcobacter butzleri12.5%0%0.81%0%
Anaerostipes hadrus0%0%1.72%0%
Bacillus amyloliquefaciens80%0%62.92%33.33%
Bacillus anthracis0.82%0%0.88%0%
Bacillus cereus1.08%1.82%18.54%0%
Bacillus subtilis62.72%0.63%45.95%5.48%
Bacillus tequilensis100%0%100%0%
Bacillus thuringiensis0%0.26%19.55%0%
Bacillus velezensis80.6%0%71.43%47.83%
Brevibacillus laterosporus0%0%5.88%0%
Campylobacter coli13.04%0%0.97%20%
Campylobacter jejuni3.16%3.96%0.32%61.54%
Enterococcus faecalis5.45%15.02%14.28%0%
Enterococcus faecium22.93%4.4%21.14%31.37%
Enterococcus hirae7.69%23.81%10.65%0%
Escherichia coli0%0%0%0%
Gardnerella vaginalis20%0%0%0%
Klebsiella pneumoniae0%0%0.01%0%
Lactobacillus johnsonii33.33%0%6.9%0%
Lactococcus garvieae0%8.33%4.44%0%
Listeria monocytogenes0%0%0.02%0%
Megasphaera stantonii0%0%25%0%
Morganella morganii0%2.5%0%0%
Providencia alcalifaciens0%0%3.45%0%
Pseudomonas aeruginosa0%0%0.01%0%
Rhizobium leguminosarum0%0%0.2%0%
Staphylococcus arlettae0%0%2.5%0%
Staphylococcus aureus2.27%3.46%3.15%1.72%
Staphylococcus capitis0%0%1.27%0%
Staphylococcus epidermidis0%0.86%4.1%0%
Staphylococcus haemolyticus0%1.89%4.4%0%
Staphylococcus hominis6.25%2.08%2.44%0%
Staphylococcus pasteuri0%5.88%0%0%
Staphylococcus pseudintermedius0%0%1.54%0%
Staphylococcus saprophyticus0%0%2.8%0%
Staphylococcus simulans0%0%1.69%0%
Staphylococcus warneri0%2.5%0.82%0%
Streptococcus agalactiae1.87%0%0.77%0%
Streptococcus anginosus17.65%0%5.85%0%
Streptococcus gallolyticus30%50%13.64%0%
Streptococcus lutetiensis0%0%10.2%0%
Streptococcus pasteurianus100%0%65%16.67%
Streptococcus pyogenes1.49%0%0.82%0%
Streptococcus suis1.6%0%4.51%0%
Streptococcus uberis0%0%2.68%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 450


>gb|AEM62948.1|-|tet(45) [Bhargavaea cecembensis]
MNTPHSHSNLRHNQILLWLCVLSFFSVLNEMVLNVSLPDIASDFNKEPASINWVNSSFILTFSIGTAVYGKLSDQLGIKKLLLFGIIVNC
FGSVIGFVGHFFFPVLILARFIQGVGAAAFPALVMVVIARYIPKENRGKAFGIIGSIVTMGEGVGPSVGGVIAEYAHWSYILLLPVVTII
TVPFLAKLLKQEEVIKGSFDTKGIIFMSVGIVFFIMFTTCYRVSFLVVSIICFLIFVKNIRKVSNPFINPSLGKNVSFMIGIICGGLIFG
TVAGFISMVPYMMKDVYQLSTAAIGSGIIFPGAMSVIVFGYIGGLLVDKKGSLFVLTTGVAFLSISFLVAALFIETTPWLITIILIFVFG
GLSFTKTVISTIVSSSLEQKEAGAGMSLLNFTSFLSEGTGIAIVGGLLSIHLLNRKLLPINAEPSTHLYSNLLLLFAGITIISWLVTIKM
HKRSRGNI


>gb|JF837330.1|-|1967-3343|tet(45) [Bhargavaea cecembensis]
GTGAATACACCTCATTCACATTCAAATTTGCGCCATAATCAAATTTTATTATGGCTCTGTGTTCTTTCTTTTTTCAGCGTTTTAAATGAA
ATGGTTTTGAATGTTTCATTACCTGATATTGCTAGTGATTTTAATAAGGAACCAGCAAGTATAAACTGGGTAAACTCATCGTTCATATTA
ACTTTTTCTATAGGAACAGCTGTATATGGAAAGCTATCGGACCAGCTAGGAATAAAAAAGCTACTCCTATTTGGGATTATAGTAAATTGC
TTCGGATCAGTTATCGGGTTTGTTGGACATTTTTTCTTTCCCGTACTTATTTTGGCTCGGTTTATTCAGGGAGTTGGCGCAGCTGCATTT
CCAGCACTTGTGATGGTGGTTATTGCGCGCTATATTCCAAAAGAAAATAGGGGTAAAGCATTTGGTATTATTGGGTCCATTGTAACTATG
GGAGAAGGTGTCGGACCATCTGTTGGTGGAGTGATTGCCGAATATGCCCATTGGTCTTATATACTGCTTTTGCCTGTTGTAACGATTATC
ACTGTTCCATTCCTTGCAAAATTATTGAAACAGGAAGAGGTAATAAAAGGATCTTTTGATACTAAAGGAATAATATTTATGTCCGTAGGC
ATTGTATTTTTTATAATGTTTACGACATGTTATAGAGTTTCCTTTCTAGTCGTTAGCATAATATGTTTCTTAATATTTGTTAAGAATATT
AGGAAAGTGTCTAATCCTTTTATTAATCCTTCGCTAGGAAAAAATGTCTCATTTATGATTGGAATCATTTGTGGAGGACTTATATTTGGA
ACCGTAGCAGGATTTATTTCTATGGTCCCTTATATGATGAAAGATGTCTATCAATTAAGTACTGCTGCAATTGGAAGTGGGATTATTTTT
CCTGGGGCAATGAGTGTTATTGTTTTCGGTTATATTGGGGGATTGCTTGTTGATAAGAAAGGTTCACTATTTGTATTAACAACTGGAGTT
GCATTTCTTTCTATAAGCTTTTTAGTAGCTGCCCTTTTTATAGAAACAACGCCTTGGCTTATAACAATTATATTAATTTTTGTTTTTGGG
GGGCTTTCTTTTACGAAAACAGTTATATCCACCATTGTTTCAAGTAGTTTGGAACAAAAGGAAGCTGGTGCTGGAATGAGTTTGCTTAAT
TTCACAAGCTTTTTATCAGAAGGAACAGGTATTGCAATTGTAGGTGGATTATTATCGATACATTTGCTAAATCGAAAATTACTACCTATA
AATGCTGAGCCATCCACTCATTTGTATAGTAATTTGCTATTACTTTTTGCAGGAATCACAATTATTAGCTGGTTGGTTACTATAAAAATG
CATAAACGCTCAAGAGGAAATATATAA