TriB

Accession ARO:3003680
CARD Short NameTriB
DefinitionTriB is a membrane protein that is fused to TriA and both are required for the triclosan efflux pump function of TriABC-OpmH in P. aeruginosa.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump
Drug Classdisinfecting agents and antiseptics
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect MatchesPseudomonas aeruginosag+wgs, Pseudomonas fluorescensg
Resistomes with Sequence VariantsEscherichia coliwgs, Pseudomonas aeruginosag+wgs, Pseudomonas fluorescensg, Serratia marcescenswgs, Stenotrophomonas maltophiliawgs
Classification9 ontology terms | Show
Parent Term(s)2 ontology terms | Show
Publications

Mima T, et al. 2007. J Bacteriol 189(21): 7600-7609. Identification and characterization of TriABC-OpmH, a triclosan efflux pump of Pseudomonas aeruginosa requiring two membrane fusion proteins. (PMID 17720796)

Resistomes

Prevalence of TriB among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Escherichia coli0%0%0.01%0%
Pseudomonas aeruginosa99.62%0%75.32%0%
Pseudomonas fluorescens2.86%0%0%0%
Serratia marcescens0%0%0.14%0%
Stenotrophomonas maltophilia0%0%0.17%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 600


>gb|AAG03547.1|+|TriB [Pseudomonas aeruginosa PAO1]
MKPFSLAGLFGFALLLSGCGDEPPPAPPRPVLTVTVKTLKNDDLGRFAGSIQARYESVLGFRTNGRIASRLFDVGDFVGKGALLATLDPT
DQQNQLRASQGDLASAEAQLIDAQANARRQEELFARSVTAQARLDDARTRLKTSQASFDQAKAAVQQARDQLSYTRLVTDFDGVITTWHA
EAGQVVSAGQAVVTLARPEVREAVFDLPTEVAESLPADARFLVSAQLDPQARTTGSIRELGPQADASTRTRRVRLSLAQTPEAFRLGSTI
QVQLSSAGSVRSVLPASVLLERDGKTQVWVVDGKQSSVALREVQVLSRDERQVVIGQGLADGDRVVRAGVNSLKPGQKIKLDEDAR


>gb|AE004091.2|+|178455-179525|TriB [Pseudomonas aeruginosa PAO1]
ATGAAGCCGTTTTCCCTCGCCGGCCTGTTCGGCTTCGCCCTGCTCCTCTCCGGCTGCGGCGACGAGCCGCCGCCGGCACCGCCGCGGCCG
GTGCTGACGGTGACCGTGAAGACCCTGAAGAACGACGACCTCGGTCGCTTCGCCGGGAGCATCCAGGCGCGCTACGAGAGCGTGCTCGGC
TTCCGCACCAACGGACGGATCGCCTCGCGCCTGTTCGACGTCGGTGACTTCGTCGGCAAGGGCGCGCTGCTGGCGACCCTCGACCCCACC
GACCAGCAGAACCAGTTGCGCGCCAGCCAGGGCGACCTGGCCAGCGCCGAGGCACAGTTGATCGACGCCCAGGCCAATGCCCGGCGCCAG
GAAGAACTGTTCGCCCGCAGCGTCACCGCCCAGGCGCGCCTGGACGATGCGCGGACCCGCCTGAAGACCAGCCAGGCCAGCTTCGACCAG
GCCAAAGCGGCGGTGCAGCAGGCCAGGGACCAGCTTTCCTACACGCGCCTGGTGACCGATTTCGACGGCGTCATCACCACCTGGCACGCC
GAGGCCGGGCAAGTGGTCAGCGCCGGCCAGGCGGTGGTCACCCTGGCCCGGCCCGAAGTGCGCGAGGCAGTCTTCGACCTGCCCACCGAG
GTCGCCGAGAGCCTGCCGGCCGACGCGCGCTTCCTGGTCAGCGCCCAGCTCGACCCGCAGGCCAGGACCACCGGCAGCATCCGCGAGCTG
GGTCCGCAGGCCGACGCCTCGACCCGCACCCGTCGCGTGCGCCTGAGCCTGGCGCAGACGCCGGAGGCGTTTCGCCTCGGTTCGACCATC
CAGGTCCAGCTGAGCAGCGCCGGTAGCGTGCGCAGCGTGCTGCCGGCCAGCGTGCTGCTGGAGCGCGACGGCAAGACCCAGGTCTGGGTC
GTCGATGGGAAACAGTCCAGCGTGGCCCTGCGCGAGGTACAGGTGCTCAGCCGCGACGAACGCCAGGTGGTGATCGGACAGGGCCTGGCC
GACGGCGACCGGGTGGTCCGCGCCGGAGTCAACAGCCTCAAGCCCGGCCAGAAGATCAAACTCGACGAGGATGCGCGATGA