fusC

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3003733
CARD Short NamefusC
DefinitionFusC is a fusidic acid resistance gene enabling ribosomal translocase EF-G dissociation from the ribosome that has been detected in Staphylococcus aureus and Staphylococcus intermedius. Its mechanism is believed to be similar to fusB due to its high level of sequence homology. It is considered a FusB-type protein.
AMR Gene FamilyTarget protecting FusB-type protein conferring resistance to Fusidic acid
Drug Classfusidane antibiotic
Resistance Mechanismantibiotic target protection
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONStaphylococcus aureus (13), Staphylococcus epidermidis (2), Staphylococcus hominis (2)
GAZ
FOODON
ENVOhospital (2)
UBERON
Classification7 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic fusidic acid [Antibiotic]
+ Target protecting FusB-type protein conferring resistance to Fusidic acid [AMR Gene Family]
Resistomes with Perfect MatchesStaphylococcus aureusg+wgs, Staphylococcus epidermidisg+wgs, Staphylococcus haemolyticuswgs, Staphylococcus hominisg+wgs, Staphylococcus pseudintermediusg
Resistomes with Sequence VariantsMacrococcoides canisg, Staphylococcus aureusg+wgs, Staphylococcus epidermidisg+wgs, Staphylococcus haemolyticuswgs, Staphylococcus hominisg+wgs, Staphylococcus pseudintermediusg
Publications

O'Neill AJ, et al. 2007. Antimicrob Agents Chemother 51(5): 1737-1740. Genetic basis of resistance to fusidic acid in staphylococci. (PMID 17325218)

Resistomes

Prevalence of fusC among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Macrococcoides canis14.29%0%0%0%0%
Staphylococcus aureus2.44%0%1.62%0%0%
Staphylococcus epidermidis3.23%0%0.84%0%0%
Staphylococcus haemolyticus0%0%7.47%0%0%
Staphylococcus hominis12.5%0%7.8%0%0%
Staphylococcus pseudintermedius1.67%0%0%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 375


>gb|CAG41812.1|+|fusC [Staphylococcus aureus subsp. aureus MSSA476]
MNKIEVYKFVKVKQLVYQLIKLYRTNDMNSHKTQKDFLLNEINDIFKEKDIDISDFITSIDDVKLTKKKAEHLLNELKVYIQDFEIPSSS
QLEKIFRKVKKLKRPDINLIDTKEISYLGWNDNSSNRKYIVYKNLDDKFEGIYGEISPNKVKGFCKICNQESDTSLFLNKTKHNKSSGTY
TKKGDYICYDSFKCNQNLDDINNLYEFIVKIK


>gb|BX571857.1|+|52820-53458|fusC [Staphylococcus aureus subsp. aureus MSSA476]
ATGAATAAAATAGAAGTGTATAAGTTTGTTAAAGTAAAGCAGTTAGTATATCAATTGATTAAGTTATATCGTACAAACGATATGAATTCC
CATAAAACACAAAAAGATTTTTTACTAAATGAAATTAATGATATCTTTAAAGAAAAAGATATTGATATCTCGGACTTTATTACATCGATT
GACGATGTAAAATTAACTAAGAAAAAAGCAGAACATCTTTTAAATGAATTAAAAGTGTACATCCAAGATTTTGAAATACCTTCATCAAGT
CAACTGGAGAAAATTTTTCGTAAAGTAAAAAAATTAAAGAGACCAGATATAAATTTAATTGATACAAAAGAAATTTCATATTTAGGATGG
AATGATAATTCTTCTAACCGAAAATATATCGTTTATAAAAATTTAGATGATAAATTCGAAGGTATATATGGCGAAATTTCACCAAATAAA
GTAAAAGGATTCTGTAAAATTTGTAATCAGGAATCTGATACATCACTCTTTCTCAATAAAACTAAACATAATAAGAGTAGTGGAACATAT
ACTAAAAAAGGAGATTACATTTGTTATGACAGTTTTAAATGTAATCAGAACCTAGATGATATAAATAATCTTTACGAATTTATTGTTAAA
ATAAAATAG

Curator Acknowledgements
Curator Description Most Recent Edit