mphE

Download Sequences

Accession	ARO:3003741
CARD Short Name	mphE
Definition	mphE is a macrolide phosphotransferase and resistance gene identified on a plasmid, pRSB105.
AMR Gene Family	macrolide phosphotransferase (MPH)
Drug Class	macrolide antibiotic
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Acinetobacter baumannii^g+p+wgs, Acinetobacter defluvii^p, Acinetobacter indicus^p+wgs, Acinetobacter johnsonii^p+wgs, Acinetobacter junii^p+wgs, Acinetobacter lwoffii^p+wgs, Acinetobacter nosocomialis^p+wgs, Acinetobacter pittii^p+wgs, Acinetobacter radioresistens^wgs, Acinetobacter towneri^p+wgs, Acinetobacter wuhouensis^p+wgs, Aeromonas caviae^g+p+wgs, Aeromonas hydrophila^p+wgs, Aeromonas veronii^g+p+wgs, Citrobacter freundii^p+wgs, Citrobacter portucalensis^p+wgs, Citrobacter werkmanii^wgs, Citrobacter youngae^p+wgs, Comamonas testosteroni^p+wgs, Enterobacter asburiae^wgs, Enterobacter cloacae^p+wgs, Enterobacter hormaechei^g+p+wgs, Enterobacter kobei^g+wgs, Enterobacter roggenkampii^wgs, Escherichia coli^g+p+wgs, Klebsiella aerogenes^p+wgs, Klebsiella huaxiensis^p, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^p+wgs, Klebsiella pneumoniae^g+p+wgs, Klebsiella quasipneumoniae^p+wgs, Leclercia adecarboxylata^g+p, Moraxella osloensis^g+wgs, Morganella morganii^g+wgs, Proteus mirabilis^g+p+wgs, Proteus penneri^wgs, Proteus vulgaris^p+wgs, Providencia rettgeri^g+p+wgs, Providencia stuartii^g+p+wgs, Pseudomonas aeruginosa^g+p+wgs, Pseudomonas putida^g+wgs, Pseudomonas stutzeri^wgs, Raoultella planticola^wgs, Salmonella enterica^g+p+wgs, Serratia marcescens^p+wgs, Shewanella putrefaciens^p, Shigella boydii^wgs, Shigella flexneri^wgs, Vibrio cholerae^g+p+wgs, Vibrio fluvialis^wgs
Resistomes with Sequence Variants	Acinetobacter baumannii^g+p+wgs, Acinetobacter defluvii^p, Acinetobacter haemolyticus^p, Acinetobacter indicus^p+wgs, Acinetobacter johnsonii^p+wgs, Acinetobacter junii^p+wgs, Acinetobacter lwoffii^p+wgs, Acinetobacter nosocomialis^p+wgs, Acinetobacter pittii^p+wgs, Acinetobacter radioresistens^wgs, Acinetobacter towneri^p+wgs, Acinetobacter wuhouensis^p+wgs, Aeromonas caviae^g+p+wgs, Aeromonas hydrophila^p+wgs, Aeromonas veronii^g+p+wgs, Citrobacter freundii^p+wgs, Citrobacter portucalensis^p+wgs, Citrobacter werkmanii^wgs, Citrobacter youngae^p+wgs, Comamonas testosteroni^p+wgs, Enterobacter asburiae^wgs, Enterobacter cloacae^p+wgs, Enterobacter hormaechei^g+p+wgs, Enterobacter kobei^g+wgs, Enterobacter roggenkampii^wgs, Escherichia coli^g+p+wgs, Klebsiella aerogenes^p+wgs, Klebsiella huaxiensis^p, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^p+wgs, Klebsiella pneumoniae^g+p+wgs, Klebsiella quasipneumoniae^p+wgs, Leclercia adecarboxylata^g+p, Moraxella osloensis^g+wgs, Morganella morganii^g+wgs, Pasteurella multocida^g, Proteus mirabilis^g+p+wgs, Proteus penneri^wgs, Proteus vulgaris^p+wgs, Providencia rettgeri^g+p+wgs, Providencia stuartii^g+p+wgs, Pseudomonas aeruginosa^g+p+wgs, Pseudomonas putida^g+wgs, Pseudomonas stutzeri^wgs, Raoultella planticola^wgs, Salmonella enterica^g+p+wgs, Serratia marcescens^p+wgs, Shewanella putrefaciens^p, Shigella boydii^wgs, Shigella flexneri^wgs, Vibrio cholerae^g+p+wgs, Vibrio fluvialis^wgs
Classification	9 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + antibiotic molecule + macrolide inactivation enzyme + phosphorylation of antibiotic conferring resistance + macrolide antibiotic [Drug Class]
Parent Term(s)	2 ontology terms \| Show + confers_resistance_to_antibiotic erythromycin [Antibiotic] + macrolide phosphotransferase (MPH) [AMR Gene Family]
Publications	Schluter A, et al. 2007. Appl Environ Microbiol 73(6): 1952-1960. Erythromycin resistance-conferring plasmid pRSB105, isolated from a sewage treatment plant, harbors a new macrolide resistance determinant, an integron-containing Tn402-like element, and a large region of unknown function. (PMID 17261525) Pawlowski AC, et al. 2018. Nat Commun 9(1):112 The evolution of substrate discrimination in macrolide antibiotic resistance enzymes. (PMID 29317655)

Resistomes

Prevalence of mphE among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Acinetobacter baumannii	36.11%	3.22%	52.51%	0%	0%
Acinetobacter baumannii	35.75%	3.17%	51.99%	0%	0%
Acinetobacter defluvii	0%	12.5%	0%	0%	0%
Acinetobacter defluvii	0%	12.5%	0%	0%	0%
Acinetobacter haemolyticus	0%	2.44%	0%	0%	0%
Acinetobacter haemolyticus	0%	0%	0%	0%	0%
Acinetobacter indicus	0%	9.43%	3.9%	0%	0%
Acinetobacter indicus	0%	9.43%	5.19%	0%	0%
Acinetobacter johnsonii	0%	4.17%	27.27%	0%	0%
Acinetobacter johnsonii	0%	4.17%	25.45%	0%	0%
Acinetobacter junii	0%	50%	11.94%	0%	0%
Acinetobacter junii	0%	50%	11.94%	0%	0%
Acinetobacter lwoffii	0%	1.39%	5.26%	0%	0%
Acinetobacter lwoffii	0%	1.39%	5.26%	0%	0%
Acinetobacter nosocomialis	0%	3.28%	6.32%	0%	0%
Acinetobacter nosocomialis	0%	3.28%	6.32%	0%	0%
Acinetobacter pittii	0%	5.42%	11.65%	0%	0%
Acinetobacter pittii	0%	4.93%	11.65%	0%	0%
Acinetobacter radioresistens	0%	0%	3.51%	0%	0%
Acinetobacter radioresistens	0%	0%	3.51%	0%	0%
Acinetobacter towneri	0%	37.5%	15.38%	0%	0%
Acinetobacter towneri	0%	37.5%	15.38%	0%	0%
Acinetobacter wuhouensis	0%	13.64%	100%	0%	0%
Acinetobacter wuhouensis	0%	13.64%	100%	0%	0%
Aeromonas caviae	2.27%	1.3%	0.54%	0%	0%
Aeromonas caviae	2.27%	1.3%	0.54%	0%	0%
Aeromonas hydrophila	0%	2.6%	0.81%	0%	0%
Aeromonas hydrophila	0%	2.6%	0.81%	0%	0%
Aeromonas veronii	3.64%	1.54%	0.56%	0%	0%
Aeromonas veronii	3.64%	1.54%	0.56%	0%	0%
Citrobacter freundii	0%	0.92%	3.87%	0%	0%
Citrobacter freundii	0%	0.92%	3.48%	0%	0%
Citrobacter portucalensis	0%	2.94%	9.01%	0%	0%
Citrobacter portucalensis	0%	2.94%	9.01%	0%	0%
Citrobacter werkmanii	0%	0%	53.85%	0%	0%
Citrobacter werkmanii	0%	0%	56.41%	0%	0%
Citrobacter youngae	0%	9.09%	6.25%	0%	0%
Citrobacter youngae	0%	9.09%	6.25%	0%	0%
Comamonas testosteroni	0%	50%	7.14%	0%	0%
Comamonas testosteroni	0%	50%	7.14%	0%	0%
Enterobacter asburiae	0%	0%	0.79%	0%	0%
Enterobacter asburiae	0%	0%	0.79%	0%	0%
Enterobacter cloacae	0%	1.12%	1.6%	0%	0%
Enterobacter cloacae	0%	1.12%	1.6%	0%	0%
Enterobacter hormaechei	0.72%	0.97%	2.76%	0%	0%
Enterobacter hormaechei	0.72%	0.97%	2.68%	0%	0%
Enterobacter kobei	4.55%	0%	7.42%	0%	0%
Enterobacter kobei	4.55%	0%	8.73%	0%	0%
Enterobacter roggenkampii	0%	0%	2.16%	0%	0%
Enterobacter roggenkampii	0%	0%	2.16%	0%	0%
Escherichia coli	0.12%	0.13%	0.42%	0%	0%
Escherichia coli	0.12%	0.12%	0.4%	0%	0%
Klebsiella aerogenes	0%	1.09%	0.28%	0%	0%
Klebsiella aerogenes	0%	1.09%	0.28%	0%	0%
Klebsiella huaxiensis	0%	7.69%	0%	0%	0%
Klebsiella huaxiensis	0%	7.69%	0%	0%	0%
Klebsiella michiganensis	0%	1.71%	1.33%	0%	0%
Klebsiella michiganensis	0%	1.71%	1.33%	0%	0%
Klebsiella oxytoca	0%	0.68%	0.84%	0%	0%
Klebsiella oxytoca	0%	1.37%	0.84%	0%	0%
Klebsiella pneumoniae	1.3%	1.74%	5.15%	0%	0%
Klebsiella pneumoniae	1.3%	1.81%	5.3%	0%	0%
Klebsiella quasipneumoniae	0%	0.64%	11.97%	0%	0%
Klebsiella quasipneumoniae	0%	0.85%	11.97%	0%	0%
Leclercia adecarboxylata	7.14%	4.76%	0%	0%	0%
Leclercia adecarboxylata	7.14%	4.76%	0%	0%	0%
Moraxella osloensis	10%	0%	7.14%	0%	0%
Moraxella osloensis	10%	0%	7.14%	0%	0%
Morganella morganii	3.85%	0%	4.91%	0%	0%
Morganella morganii	3.85%	0%	4.91%	0%	0%
Pasteurella multocida	3.57%	0%	0%	0%	0%
Pasteurella multocida	0%	0%	0%	0%	0%
Proteus mirabilis	12.84%	8.75%	7.43%	0%	0%
Proteus mirabilis	12.84%	8.75%	7.43%	0%	0%
Proteus penneri	0%	0%	12.5%	0%	0%
Proteus penneri	0%	0%	12.5%	0%	0%
Proteus vulgaris	0%	22.22%	11.11%	0%	0%
Proteus vulgaris	0%	22.22%	16.67%	0%	0%
Providencia rettgeri	14.71%	8.11%	17.2%	0%	0%
Providencia rettgeri	14.71%	8.11%	17.2%	0%	0%
Providencia stuartii	6.25%	11.36%	13.64%	0%	0%
Providencia stuartii	6.25%	11.36%	13.64%	0%	0%
Pseudomonas aeruginosa	0.46%	4.09%	0.64%	0%	0%
Pseudomonas aeruginosa	0.46%	4.09%	0.68%	0%	0%
Pseudomonas putida	1.41%	0%	0.53%	0%	0%
Pseudomonas putida	1.41%	0%	0.53%	0%	0%
Pseudomonas stutzeri	0%	0%	2.29%	0%	0%
Pseudomonas stutzeri	0%	0%	2.29%	0%	0%
Raoultella planticola	0%	0%	5.13%	0%	0%
Raoultella planticola	0%	0%	5.13%	0%	0%
Salmonella enterica	0.57%	0.27%	0.47%	0%	0%
Salmonella enterica	0.5%	0.27%	0.47%	0%	0%
Serratia marcescens	0%	1.29%	0.66%	0%	0%
Serratia marcescens	0%	1.29%	0.66%	0%	0%
Shewanella putrefaciens	0%	20%	0%	0%	0%
Shewanella putrefaciens	0%	20%	0%	0%	0%
Shigella boydii	0%	0%	1.11%	0%	0%
Shigella boydii	0%	0%	1.11%	0%	0%
Shigella flexneri	0%	0%	0.16%	0%	0%
Shigella flexneri	0%	0%	0.16%	0%	0%
Vibrio cholerae	0.45%	10.53%	0.89%	0%	0%
Vibrio cholerae	0.45%	10.53%	0.89%	0%	0%
Vibrio fluvialis	0%	0%	25.33%	0%	0%
Vibrio fluvialis	0%	0%	25.33%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500

Type of Antibiotic Resistance: Acquired

Protein
DNA

>gb|ABI20451.1|-|mphE [uncultured bacterium]
MTIQDIQSLAEAHGLLLTDKMNFNEMGIDFKVVFALDTKGQQWLLRIPRRDGMREQIKKEKRILELVKKHLSVEVPDWRISSTELVAYPI
LKDNPVLNLDAETYEIIWNMDKDSPKYITSLAKTLFEIHSIPEKEVRENDLKIMKPSDLRPEIANNLQLVKSEIGISEQLETRYRKWLDN
DVLWADFTQFIHGDLYAGHVLASKDGAVSGVIDWSTAHIDDPAIDFAGHVTLFGEESLKTLIIEYEKLGGKVWNKLYEQTLERAAASPLM
YGLFALETQNESLIVGAKAQLGVI

>gb|DQ839391.1|-|12873-13757|mphE [uncultured bacterium]
ATGACAATTCAAGATATTCAATCACTTGCTGAAGCACACGGCTTGTTGCTTACGGACAAAATGAATTTCAATGAAATGGGCATTGATTTT
AAGGTCGTTTTTGCTCTTGATACAAAGGGGCAACAATGGTTGCTGCGTATTCCTCGTCGTGATGGCATGAGGGAACAAATCAAGAAAGAA
AAACGCATTTTAGAATTGGTAAAAAAACATCTTTCTGTAGAGGTTCCTGATTGGAGAATTTCATCTACAGAATTAGTGGCTTATCCCATA
CTTAAAGATAATCCTGTTTTAAATTTGGATGCTGAAACCTATGAAATAATTTGGAATATGGACAAAGATAGCCCGAAATACATAACATCT
TTGGCAAAAACCTTATTTGAAATCCATAGTATTCCTGAAAAAGAAGTTCGGGAAAATGATTTGAAAATTATGAAACCTTCAGATTTAAGA
CCTGAAATAGCAAACAATTTGCAGTTAGTAAAATCTGAAATTGGTATAAGTGAGCAATTGGAAACCCGCTACAGAAAATGGTTGGATAAT
GATGTTCTATGGGCAGATTTCACCCAATTTATACATGGCGATTTATATGCTGGGCATGTACTAGCTTCAAAGGATGGAGCTGTTTCAGGC
GTTATTGATTGGTCAACAGCCCATATAGATGACCCAGCGATTGATTTTGCTGGGCATGTAACTTTGTTTGGAGAAGAAAGCCTCAAAACT
CTAATCATCGAGTATGAAAAACTAGGGGGTAAAGTTTGGAATAAACTATATGAACAGACTTTAGAAAGAGCAGCGGCCTCTCCTTTGATG
TATGGTTTATTTGCCTTAGAAACTCAAAATGAAAGCCTTATCGTTGGAGCAAAAGCTCAGTTGGGAGTTATATAA

Curator Acknowledgements

Curator	Description	Most Recent Edit

mphE

Prevalence: protein homolog model (view sequences)

Graph