mphE

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3003741
CARD Short NamemphE
DefinitionmphE is a macrolide phosphotransferase and resistance gene identified on a plasmid, pRSB105.
AMR Gene Familymacrolide phosphotransferase (MPH)
Drug Classmacrolide antibiotic
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONAcinetobacter (2), Acinetobacter baumannii (2)
GAZ
FOODON
ENVO
UBERON
Classification9 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic erythromycin [Antibiotic]
+ macrolide phosphotransferase (MPH) [AMR Gene Family]
Resistomes with Perfect MatchesAcinetobacter baumanniig+p+wgs, Acinetobacter defluviip, Acinetobacter indicusp+wgs, Acinetobacter johnsoniip+wgs, Acinetobacter juniip+wgs, Acinetobacter lwoffiip+wgs, Acinetobacter nosocomialisp+wgs, Acinetobacter pittiip+wgs, Acinetobacter radioresistenswgs, Acinetobacter townerip+wgs, Acinetobacter wuhouensisp+wgs, Aeromonas caviaeg+p+wgs, Aeromonas hydrophilap+wgs, Aeromonas veroniig+p+wgs, Citrobacter freundiip+wgs, Citrobacter portucalensisp+wgs, Citrobacter werkmaniiwgs, Citrobacter youngaep+wgs, Comamonas testosteronip+wgs, Enterobacter asburiaewgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeig+wgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs, Faucicola osloensisg+wgs, Klebsiella aerogenesp+wgs, Klebsiella huaxiensisp, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatag+p, Morganella morganiig+wgs, Proteus mirabilisg+p+wgs, Proteus penneriwgs, Proteus vulgarisp+wgs, Providencia rettgerig+p+wgs, Providencia stuartiig+p+wgs, Pseudomonas aeruginosag+p+wgs, Pseudomonas putidag+wgs, Raoultella planticolawgs, Salmonella entericag+p+wgs, Serratia marcescensp+wgs, Shewanella putrefaciensp, Shigella boydiiwgs, Shigella flexneriwgs, Stutzerimonas stutzeriwgs, Vibrio choleraeg+p+wgs, Vibrio fluvialiswgs
Resistomes with Sequence VariantsAcinetobacter baumanniig+p+wgs, Acinetobacter defluviip, Acinetobacter haemolyticusp, Acinetobacter indicusp+wgs, Acinetobacter johnsoniip+wgs, Acinetobacter juniip+wgs, Acinetobacter lwoffiip+wgs, Acinetobacter nosocomialisp+wgs, Acinetobacter pittiip+wgs, Acinetobacter radioresistenswgs, Acinetobacter townerip+wgs, Acinetobacter wuhouensisp+wgs, Aeromonas caviaeg+p+wgs, Aeromonas hydrophilap+wgs, Aeromonas veroniig+p+wgs, Citrobacter freundiip+wgs, Citrobacter portucalensisp+wgs, Citrobacter werkmaniiwgs, Citrobacter youngaep+wgs, Comamonas testosteronip+wgs, Enterobacter asburiaewgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeig+wgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs, Faucicola osloensisg+wgs, Klebsiella aerogenesp+wgs, Klebsiella huaxiensisp, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatag+p, Morganella morganiig+wgs, Pasteurella multocidag, Proteus mirabilisg+p+wgs, Proteus penneriwgs, Proteus vulgarisp+wgs, Providencia rettgerig+p+wgs, Providencia stuartiig+p+wgs, Pseudomonas aeruginosag+p+wgs, Pseudomonas putidag+wgs, Raoultella planticolawgs, Salmonella entericag+p+wgs, Serratia marcescensp+wgs, Shewanella putrefaciensp, Shigella boydiiwgs, Shigella flexneriwgs, Stutzerimonas stutzeriwgs, Vibrio choleraeg+p+wgs, Vibrio fluvialiswgs
Publications

Schluter A, et al. 2007. Appl Environ Microbiol 73(6): 1952-1960. Erythromycin resistance-conferring plasmid pRSB105, isolated from a sewage treatment plant, harbors a new macrolide resistance determinant, an integron-containing Tn402-like element, and a large region of unknown function. (PMID 17261525)

Pawlowski AC, et al. 2018. Nat Commun 9(1):112 The evolution of substrate discrimination in macrolide antibiotic resistance enzymes. (PMID 29317655)

Resistomes

Prevalence of mphE among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii36.11%3.22%52.51%0%0%
Acinetobacter defluvii0%12.5%0%0%0%
Acinetobacter haemolyticus0%2.44%0%0%0%
Acinetobacter indicus0%9.43%5.19%0%0%
Acinetobacter johnsonii0%4.17%27.27%0%0%
Acinetobacter junii0%50%11.94%0%0%
Acinetobacter lwoffii0%1.39%5.26%0%0%
Acinetobacter nosocomialis0%3.28%6.32%0%0%
Acinetobacter pittii0%5.42%11.65%0%0%
Acinetobacter radioresistens0%0%3.51%0%0%
Acinetobacter towneri0%37.5%15.38%0%0%
Acinetobacter wuhouensis0%13.64%100%0%0%
Aeromonas caviae2.27%1.3%0.54%0%0%
Aeromonas hydrophila0%2.6%0.81%0%0%
Aeromonas veronii3.64%1.54%0.56%0%0%
Citrobacter freundii0%0.92%3.87%0%0%
Citrobacter portucalensis0%2.94%9.01%0%0%
Citrobacter werkmanii0%0%56.41%0%0%
Citrobacter youngae0%9.09%6.25%0%0%
Comamonas testosteroni0%50%7.14%0%0%
Enterobacter asburiae0%0%0.79%0%0%
Enterobacter cloacae0%1.12%1.6%0%0%
Enterobacter hormaechei0.72%0.97%2.76%0%0%
Enterobacter kobei4.55%0%8.73%0%0%
Enterobacter roggenkampii0%0%2.16%0%0%
Escherichia coli0.12%0.13%0.42%0%0%
Faucicola osloensis10%0%7.14%0%0%
Klebsiella aerogenes0%1.09%0.28%0%0%
Klebsiella huaxiensis0%7.69%0%0%0%
Klebsiella michiganensis0%1.71%1.33%0%0%
Klebsiella oxytoca0%1.37%0.84%0%0%
Klebsiella pneumoniae1.3%1.81%5.3%0%0%
Klebsiella quasipneumoniae0%0.85%11.97%0%0%
Leclercia adecarboxylata7.14%4.76%0%0%0%
Morganella morganii3.85%0%4.91%0%0%
Pasteurella multocida3.57%0%0%0%0%
Proteus mirabilis12.84%8.75%7.43%0%0%
Proteus penneri0%0%12.5%0%0%
Proteus vulgaris0%22.22%16.67%0%0%
Providencia rettgeri14.71%8.11%17.2%0%0%
Providencia stuartii6.25%11.36%13.64%0%0%
Pseudomonas aeruginosa0.46%4.09%0.68%0%0%
Pseudomonas putida1.41%0%0.53%0%0%
Raoultella planticola0%0%5.13%0%0%
Salmonella enterica0.57%0.27%0.47%0%0%
Serratia marcescens0%1.29%0.66%0%0%
Shewanella putrefaciens0%20%0%0%0%
Shigella boydii0%0%1.11%0%0%
Shigella flexneri0%0%0.16%0%0%
Stutzerimonas stutzeri0%0%2.29%0%0%
Vibrio cholerae0.45%10.53%0.89%0%0%
Vibrio fluvialis0%0%25.33%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500

Type of Antibiotic Resistance: Acquired


>gb|ABI20451.1|-|mphE [uncultured bacterium]
MTIQDIQSLAEAHGLLLTDKMNFNEMGIDFKVVFALDTKGQQWLLRIPRRDGMREQIKKEKRILELVKKHLSVEVPDWRISSTELVAYPI
LKDNPVLNLDAETYEIIWNMDKDSPKYITSLAKTLFEIHSIPEKEVRENDLKIMKPSDLRPEIANNLQLVKSEIGISEQLETRYRKWLDN
DVLWADFTQFIHGDLYAGHVLASKDGAVSGVIDWSTAHIDDPAIDFAGHVTLFGEESLKTLIIEYEKLGGKVWNKLYEQTLERAAASPLM
YGLFALETQNESLIVGAKAQLGVI


>gb|DQ839391.1|-|12873-13757|mphE [uncultured bacterium]
ATGACAATTCAAGATATTCAATCACTTGCTGAAGCACACGGCTTGTTGCTTACGGACAAAATGAATTTCAATGAAATGGGCATTGATTTT
AAGGTCGTTTTTGCTCTTGATACAAAGGGGCAACAATGGTTGCTGCGTATTCCTCGTCGTGATGGCATGAGGGAACAAATCAAGAAAGAA
AAACGCATTTTAGAATTGGTAAAAAAACATCTTTCTGTAGAGGTTCCTGATTGGAGAATTTCATCTACAGAATTAGTGGCTTATCCCATA
CTTAAAGATAATCCTGTTTTAAATTTGGATGCTGAAACCTATGAAATAATTTGGAATATGGACAAAGATAGCCCGAAATACATAACATCT
TTGGCAAAAACCTTATTTGAAATCCATAGTATTCCTGAAAAAGAAGTTCGGGAAAATGATTTGAAAATTATGAAACCTTCAGATTTAAGA
CCTGAAATAGCAAACAATTTGCAGTTAGTAAAATCTGAAATTGGTATAAGTGAGCAATTGGAAACCCGCTACAGAAAATGGTTGGATAAT
GATGTTCTATGGGCAGATTTCACCCAATTTATACATGGCGATTTATATGCTGGGCATGTACTAGCTTCAAAGGATGGAGCTGTTTCAGGC
GTTATTGATTGGTCAACAGCCCATATAGATGACCCAGCGATTGATTTTGCTGGGCATGTAACTTTGTTTGGAGAAGAAAGCCTCAAAACT
CTAATCATCGAGTATGAAAAACTAGGGGGTAAAGTTTGGAATAAACTATATGAACAGACTTTAGAAAGAGCAGCGGCCTCTCCTTTGATG
TATGGTTTATTTGCCTTAGAAACTCAAAATGAAAGCCTTATCGTTGGAGCAAAAGCTCAGTTGGGAGTTATATAA

Curator Acknowledgements
Curator Description Most Recent Edit