lnuE

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3003762
Synonym(s)linE
CARD Short NamelnuE
DefinitionlnuE encodes a lincosamide resistance gene isolated from Streptococcus suis that was truncated by an ISEnfa5-cfr-ISEnfa5 segment insertion. It shares the closest sequence similarity to lnuA.
AMR Gene Familylincosamide nucleotidyltransferase (LNU)
Drug Classlincosamide antibiotic
Resistance Mechanismantibiotic inactivation
Classification8 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic lincomycin [Antibiotic]
+ lincosamide nucleotidyltransferase (LNU) [AMR Gene Family]
Resistomes with Perfect MatchesEnterococcus faecaliswgs
Resistomes with Sequence VariantsEnterococcus faecaliswgs
Publications

Zhao Q, et al. 2014. Antimicrob. Agents Chemother. 58(3):1785-8 Identification of the novel lincosamide resistance gene lnu(E) truncated by ISEnfa5-cfr-ISEnfa5 insertion in Streptococcus suis: de novo synthesis and confirmation of functional activity in Staphylococcus aureus. (PMID 24366733)

Resistomes

Prevalence of lnuE among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Enterococcus faecalis0%0%0.04%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300


>gb|AGT57825.1|+|lnuE [synthetic construct]
MGKNNVTEKHLFYILDLLKDLQITYWLDGGWGVDVLTGKQQREHRDIDIDFDSQHTDKLVKKLKEIGYITVVDWMPSRMELKHEEYGYLD
IHPLDLKKDGTATQADPKGGFYLFEKDWFTTTNYKNRKIPCISKEAQLLFHSGYELTEKDQFDIKNLNSINQVKKEGHFSNDF


>gb|KF287643.1|+|1-522|lnuE [synthetic construct]
TTGGGAAAAAATAATGTCACAGAAAAACATCTATTTTATATTTTAGATTTACTTAAAGACCTCCAAATAACTTATTGGTTAGACGGTGGA
TGGGGAGTAGATGTACTCACTGGAAAGCAACAGAGAGAACACAGAGACATAGATATCGATTTTGATTCACAACATACAGACAAATTAGTT
AAAAAATTAAAAGAGATTGGATACATCACAGTTGTAGATTGGATGCCTTCCAGAATGGAATTAAAACACGAAGAATACGGATATTTAGAT
ATACATCCCTTAGATTTAAAAAAAGATGGCACAGCAACTCAAGCCGATCCAAAAGGCGGTTTTTATCTATTCGAAAAAGATTGGTTCACA
ACTACAAATTACAAAAATCGAAAAATACCATGCATTTCAAAAGAAGCACAACTACTTTTTCACTCTGGATATGAATTAACAGAAAAAGAC
CAATTTGATATTAAAAATTTAAACTCAATAAATCAAGTTAAGAAAGAAGGTCATTTTTCAAATGACTTCTAA

Curator Acknowledgements
Curator Description Most Recent Edit